BLASTX nr result
ID: Paeonia25_contig00043953
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00043953 (300 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007364948.1| ubiquitin conjugating enzyme family protein ... 57 3e-06 >ref|XP_007364948.1| ubiquitin conjugating enzyme family protein [Dichomitus squalens LYAD-421 SS1] gi|395329851|gb|EJF62236.1| ubiquitin conjugating enzyme family protein [Dichomitus squalens LYAD-421 SS1] Length = 917 Score = 57.0 bits (136), Expect = 3e-06 Identities = 34/70 (48%), Positives = 39/70 (55%) Frame = -3 Query: 211 MERHIQQLVEMGXXXXXXXXXXXQYKDVMQAAEQFFEGKFXXXXXXXXDTPMTPSSNLAA 32 MER +QQLVEMG Q+KDVM+AAE F+G F D MTPS LA Sbjct: 1 MEREVQQLVEMGATVAQARAALKQHKDVMEAAEHIFDGSFDHVVDDDGDVEMTPSERLA- 59 Query: 31 SSSKPRMMTP 2 KPRM+TP Sbjct: 60 --PKPRMITP 67