BLASTX nr result
ID: Paeonia25_contig00043839
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00043839 (281 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMD31075.1| hypothetical protein CERSUDRAFT_89481 [Ceriporiop... 47 3e-06 >gb|EMD31075.1| hypothetical protein CERSUDRAFT_89481 [Ceriporiopsis subvermispora B] Length = 759 Score = 47.4 bits (111), Expect(2) = 3e-06 Identities = 26/64 (40%), Positives = 38/64 (59%), Gaps = 7/64 (10%) Frame = +1 Query: 1 QCFFISYYKIKKRLW--WRGMRIQASGEPQD-SGHEDGP----AESPCIPAAEGMGEYEV 159 QC F+ YYK++ R + WRG+ I+A+ EP+D ++DGP A + A+ M E E Sbjct: 243 QCIFLMYYKVRSRRFRVWRGVDIRAAAEPRDLDPYDDGPPTSGASAAATEVAQEMVEVES 302 Query: 160 VEGP 171 V GP Sbjct: 303 VPGP 306 Score = 29.3 bits (64), Expect(2) = 3e-06 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +3 Query: 246 DPVDDILDYILN 281 DPVDDILDYILN Sbjct: 311 DPVDDILDYILN 322