BLASTX nr result
ID: Paeonia25_contig00043757
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00043757 (290 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN69962.1| hypothetical protein VITISV_008740 [Vitis vinifera] 59 9e-07 >emb|CAN69962.1| hypothetical protein VITISV_008740 [Vitis vinifera] Length = 809 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/46 (56%), Positives = 34/46 (73%) Frame = +2 Query: 2 KNIDIVWVLNSNKEKFEKKFVTQFKLIAPEVMKAYQGKMSFEGFNN 139 KN D+VW+LN +K+ FE KF+ FK APEV+KAYQ M +GFN+ Sbjct: 754 KNFDVVWILNLDKKTFETKFLIPFKDDAPEVIKAYQEGMGLQGFND 799