BLASTX nr result
ID: Paeonia25_contig00043697
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00043697 (249 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006602905.1| PREDICTED: probable leucine-rich repeat rece... 71 2e-10 ref|XP_003621164.1| Receptor kinase [Medicago truncatula] gi|355... 66 4e-09 ref|XP_007140376.1| hypothetical protein PHAVU_008G106500g [Phas... 66 6e-09 ref|XP_006493668.1| PREDICTED: probable LRR receptor-like serine... 65 7e-09 ref|XP_006431110.1| hypothetical protein CICLE_v10013898mg, part... 65 7e-09 ref|XP_006428855.1| hypothetical protein CICLE_v10012486mg [Citr... 65 7e-09 ref|XP_007048745.1| Leucine-rich repeat receptor protein kinase ... 65 7e-09 ref|XP_006494593.1| PREDICTED: probable leucine-rich repeat rece... 65 1e-08 ref|XP_002301914.2| hypothetical protein POPTR_0002s00940g, part... 65 1e-08 ref|XP_006480685.1| PREDICTED: probable leucine-rich repeat rece... 65 1e-08 ref|XP_007010909.1| Leucine-rich repeat receptor-like protein ki... 65 1e-08 ref|XP_002318299.1| putative leucine-rich repeat transmembrane p... 65 1e-08 ref|XP_006428841.1| hypothetical protein CICLE_v10011171mg [Citr... 64 2e-08 ref|XP_006386493.1| hypothetical protein POPTR_0002s12290g, part... 64 2e-08 ref|XP_006386490.1| hypothetical protein POPTR_0002s12260g, part... 64 2e-08 ref|XP_007010902.1| Kinase family protein with leucine-rich repe... 64 2e-08 ref|XP_007010865.1| Leucine-rich repeat receptor-like protein ki... 64 2e-08 ref|XP_003622584.1| Receptor protein kinase-like protein [Medica... 64 2e-08 ref|XP_006493152.1| PREDICTED: probable LRR receptor-like serine... 64 2e-08 ref|XP_006371292.1| hypothetical protein POPTR_0019s08770g [Popu... 64 2e-08 >ref|XP_006602905.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At1g35710-like [Glycine max] Length = 797 Score = 70.9 bits (172), Expect = 2e-10 Identities = 37/55 (67%), Positives = 38/55 (69%) Frame = +1 Query: 85 KFEKFNFFCFPNLVHLNLAQNSIHGSIPSQIGALSKLTYLDLSSNRISGPIPSQI 249 K +FNF CF NLVHLNLA I GSIP G LSKLTYLDLS N I G IPS I Sbjct: 94 KLWRFNFSCFQNLVHLNLAALGISGSIPYGFGTLSKLTYLDLSFNDIMGTIPSDI 148 >ref|XP_003621164.1| Receptor kinase [Medicago truncatula] gi|355496179|gb|AES77382.1| Receptor kinase [Medicago truncatula] Length = 799 Score = 66.2 bits (160), Expect = 4e-09 Identities = 33/55 (60%), Positives = 40/55 (72%) Frame = +1 Query: 85 KFEKFNFFCFPNLVHLNLAQNSIHGSIPSQIGALSKLTYLDLSSNRISGPIPSQI 249 KF KF+F F NLVHLNLA + I G+IP ++ LSKL +LD+SSN I G IPS I Sbjct: 79 KFGKFHFSSFTNLVHLNLASHGIIGNIPFELATLSKLIFLDVSSNDIEGHIPSNI 133 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/50 (52%), Positives = 36/50 (72%) Frame = +1 Query: 100 NFFCFPNLVHLNLAQNSIHGSIPSQIGALSKLTYLDLSSNRISGPIPSQI 249 N + NL+ LNL++N ++GSIPS IG L+KLT+L L +N SG IP +I Sbjct: 132 NIWSLKNLITLNLSRNKLNGSIPSSIGQLTKLTFLHLDANMFSGSIPLEI 181 >ref|XP_007140376.1| hypothetical protein PHAVU_008G106500g [Phaseolus vulgaris] gi|561013509|gb|ESW12370.1| hypothetical protein PHAVU_008G106500g [Phaseolus vulgaris] Length = 1032 Score = 65.9 bits (159), Expect = 6e-09 Identities = 30/53 (56%), Positives = 41/53 (77%) Frame = +1 Query: 91 EKFNFFCFPNLVHLNLAQNSIHGSIPSQIGALSKLTYLDLSSNRISGPIPSQI 249 + NF PN++ L+++ NS+ GSIP QIG LSKLT+LDLS N ++GPIPS+I Sbjct: 97 QTLNFSSLPNILTLDMSLNSLSGSIPPQIGVLSKLTHLDLSLNHLTGPIPSEI 149 >ref|XP_006493668.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g08850-like [Citrus sinensis] Length = 993 Score = 65.5 bits (158), Expect = 7e-09 Identities = 35/75 (46%), Positives = 48/75 (64%) Frame = +1 Query: 25 NHLKSNKVFAFISLINTE*YKFEKFNFFCFPNLVHLNLAQNSIHGSIPSQIGALSKLTYL 204 NH +S + +S + F+ F+F FP+LV LNL N + G+IP QIG LSKL YL Sbjct: 73 NHARSRVIRINLSTLGLN-GTFQDFSFSSFPHLVKLNLGFNLLFGNIPPQIGNLSKLQYL 131 Query: 205 DLSSNRISGPIPSQI 249 DL +N++SG IP +I Sbjct: 132 DLGNNQLSGVIPPEI 146 >ref|XP_006431110.1| hypothetical protein CICLE_v10013898mg, partial [Citrus clementina] gi|557533167|gb|ESR44350.1| hypothetical protein CICLE_v10013898mg, partial [Citrus clementina] Length = 937 Score = 65.5 bits (158), Expect = 7e-09 Identities = 30/55 (54%), Positives = 41/55 (74%) Frame = +1 Query: 85 KFEKFNFFCFPNLVHLNLAQNSIHGSIPSQIGALSKLTYLDLSSNRISGPIPSQI 249 K ++FNF CFPNL + ++I G+IPS+IGALSKL LDLS N ++G IPS++ Sbjct: 91 KLDQFNFSCFPNLESFRIWYSNISGNIPSEIGALSKLQILDLSHNNLTGTIPSKL 145 >ref|XP_006428855.1| hypothetical protein CICLE_v10012486mg [Citrus clementina] gi|557530912|gb|ESR42095.1| hypothetical protein CICLE_v10012486mg [Citrus clementina] Length = 265 Score = 65.5 bits (158), Expect = 7e-09 Identities = 30/52 (57%), Positives = 38/52 (73%) Frame = +1 Query: 94 KFNFFCFPNLVHLNLAQNSIHGSIPSQIGALSKLTYLDLSSNRISGPIPSQI 249 + NF CFPNL +L+L NS+ GSIPSQIG+LS L YL L N ++G IP +I Sbjct: 94 RLNFSCFPNLQYLDLWNNSLSGSIPSQIGSLSNLKYLGLDQNNLTGTIPKEI 145 >ref|XP_007048745.1| Leucine-rich repeat receptor protein kinase family protein [Theobroma cacao] gi|508701006|gb|EOX92902.1| Leucine-rich repeat receptor protein kinase family protein [Theobroma cacao] Length = 1026 Score = 65.5 bits (158), Expect = 7e-09 Identities = 31/55 (56%), Positives = 40/55 (72%) Frame = +1 Query: 85 KFEKFNFFCFPNLVHLNLAQNSIHGSIPSQIGALSKLTYLDLSSNRISGPIPSQI 249 K E NF FPNL H++L+ NS+HG+IPSQIG L KL YL+ S N + G IP++I Sbjct: 136 KLEGLNFSLFPNLTHIDLSINSLHGNIPSQIGHLPKLVYLNFSFNYLHGFIPNKI 190 >ref|XP_006494593.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At1g35710-like [Citrus sinensis] Length = 800 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/55 (54%), Positives = 39/55 (70%) Frame = +1 Query: 85 KFEKFNFFCFPNLVHLNLAQNSIHGSIPSQIGALSKLTYLDLSSNRISGPIPSQI 249 + +FNF CFP L L+L N + GSIPSQ+GALSKL YLD S N ++G IP ++ Sbjct: 91 ELSQFNFSCFPGLESLSLRFNYLFGSIPSQVGALSKLRYLDFSFNNLTGSIPPEL 145 >ref|XP_002301914.2| hypothetical protein POPTR_0002s00940g, partial [Populus trichocarpa] gi|550344016|gb|EEE81187.2| hypothetical protein POPTR_0002s00940g, partial [Populus trichocarpa] Length = 880 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/55 (54%), Positives = 39/55 (70%) Frame = +1 Query: 85 KFEKFNFFCFPNLVHLNLAQNSIHGSIPSQIGALSKLTYLDLSSNRISGPIPSQI 249 KF K NF CF NL L+LA + + GSIP QI L +LTYL+LSSN ++G +PS + Sbjct: 54 KFGKMNFSCFSNLARLHLANHELSGSIPPQISILPQLTYLNLSSNNLAGELPSSL 108 >ref|XP_006480685.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At1g35710-like [Citrus sinensis] Length = 545 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/52 (55%), Positives = 38/52 (73%) Frame = +1 Query: 94 KFNFFCFPNLVHLNLAQNSIHGSIPSQIGALSKLTYLDLSSNRISGPIPSQI 249 + NF CFPNL +LNL N++ GSIP QIG+LS L YL+L N ++G IP +I Sbjct: 94 RLNFSCFPNLQYLNLGNNNLSGSIPPQIGSLSNLKYLNLRWNNLTGTIPKEI 145 >ref|XP_007010909.1| Leucine-rich repeat receptor-like protein kinase family protein, putative [Theobroma cacao] gi|508727822|gb|EOY19719.1| Leucine-rich repeat receptor-like protein kinase family protein, putative [Theobroma cacao] Length = 1170 Score = 64.7 bits (156), Expect = 1e-08 Identities = 31/50 (62%), Positives = 38/50 (76%) Frame = +1 Query: 100 NFFCFPNLVHLNLAQNSIHGSIPSQIGALSKLTYLDLSSNRISGPIPSQI 249 NFF PNL+ L L NS++G +PSQIG LSKL++LDLS N SG IPS+I Sbjct: 93 NFFSLPNLMGLGLRNNSLYGGLPSQIGNLSKLSFLDLSYNDFSGNIPSEI 142 >ref|XP_002318299.1| putative leucine-rich repeat transmembrane protein kinase [Populus trichocarpa] gi|222858972|gb|EEE96519.1| putative leucine-rich repeat transmembrane protein kinase [Populus trichocarpa] Length = 993 Score = 64.7 bits (156), Expect = 1e-08 Identities = 32/50 (64%), Positives = 40/50 (80%) Frame = +1 Query: 100 NFFCFPNLVHLNLAQNSIHGSIPSQIGALSKLTYLDLSSNRISGPIPSQI 249 NF FP+L+ LNL+ NS++G+IPSQI LS+LT LDLS N ISG IPS+I Sbjct: 104 NFSSFPSLMKLNLSNNSLYGTIPSQISNLSRLTILDLSYNDISGNIPSEI 153 >ref|XP_006428841.1| hypothetical protein CICLE_v10011171mg [Citrus clementina] gi|557530898|gb|ESR42081.1| hypothetical protein CICLE_v10011171mg [Citrus clementina] Length = 725 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/52 (55%), Positives = 39/52 (75%) Frame = +1 Query: 94 KFNFFCFPNLVHLNLAQNSIHGSIPSQIGALSKLTYLDLSSNRISGPIPSQI 249 + NF CFPNL +L+L+ N++ GSI SQIG+LS L YLDL N ++G IP +I Sbjct: 94 RLNFSCFPNLQYLDLSNNNLSGSILSQIGSLSNLKYLDLDRNNLTGTIPKEI 145 >ref|XP_006386493.1| hypothetical protein POPTR_0002s12290g, partial [Populus trichocarpa] gi|550344850|gb|ERP64290.1| hypothetical protein POPTR_0002s12290g, partial [Populus trichocarpa] Length = 248 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/55 (54%), Positives = 39/55 (70%) Frame = +1 Query: 85 KFEKFNFFCFPNLVHLNLAQNSIHGSIPSQIGALSKLTYLDLSSNRISGPIPSQI 249 KF K NF CF NLV L+LA + + GSIP QI L +L YL+LSSN ++G +PS + Sbjct: 92 KFGKMNFSCFSNLVRLHLANHELSGSIPPQISILPQLRYLNLSSNNLAGELPSSL 146 >ref|XP_006386490.1| hypothetical protein POPTR_0002s12260g, partial [Populus trichocarpa] gi|550344846|gb|ERP64287.1| hypothetical protein POPTR_0002s12260g, partial [Populus trichocarpa] Length = 534 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/55 (54%), Positives = 39/55 (70%) Frame = +1 Query: 85 KFEKFNFFCFPNLVHLNLAQNSIHGSIPSQIGALSKLTYLDLSSNRISGPIPSQI 249 KF K NF CF NLV L+LA + + GSIP QI L +L YL+LSSN ++G +PS + Sbjct: 80 KFGKMNFSCFSNLVRLHLANHELSGSIPPQISILPQLRYLNLSSNNLAGELPSSL 134 >ref|XP_007010902.1| Kinase family protein with leucine-rich repeat domain [Theobroma cacao] gi|508727815|gb|EOY19712.1| Kinase family protein with leucine-rich repeat domain [Theobroma cacao] Length = 440 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/50 (62%), Positives = 37/50 (74%) Frame = +1 Query: 100 NFFCFPNLVHLNLAQNSIHGSIPSQIGALSKLTYLDLSSNRISGPIPSQI 249 NFF FP L++L L NS++G IPS IG LSKL +LDLS N SG IPS+I Sbjct: 83 NFFSFPKLMNLELRNNSLYGPIPSHIGNLSKLIFLDLSYNNFSGNIPSEI 132 >ref|XP_007010865.1| Leucine-rich repeat receptor-like protein kinase family protein, putative [Theobroma cacao] gi|508727778|gb|EOY19675.1| Leucine-rich repeat receptor-like protein kinase family protein, putative [Theobroma cacao] Length = 1102 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/50 (62%), Positives = 37/50 (74%) Frame = +1 Query: 100 NFFCFPNLVHLNLAQNSIHGSIPSQIGALSKLTYLDLSSNRISGPIPSQI 249 NFF FP L++L L NS++G IPS IG LSKL +LDLS N SG IPS+I Sbjct: 97 NFFSFPKLMNLQLRNNSLYGPIPSHIGNLSKLIFLDLSYNNFSGNIPSEI 146 >ref|XP_003622584.1| Receptor protein kinase-like protein [Medicago truncatula] gi|355497599|gb|AES78802.1| Receptor protein kinase-like protein [Medicago truncatula] Length = 1083 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/53 (58%), Positives = 38/53 (71%) Frame = +1 Query: 91 EKFNFFCFPNLVHLNLAQNSIHGSIPSQIGALSKLTYLDLSSNRISGPIPSQI 249 E NF PN+ LN++ NS++GSIPS IG LSKLT+LDLS N SG IP +I Sbjct: 91 ESLNFSSLPNIQTLNISHNSLNGSIPSHIGMLSKLTHLDLSDNLFSGTIPYEI 143 >ref|XP_006493152.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g08850-like [Citrus sinensis] Length = 1030 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/52 (59%), Positives = 39/52 (75%) Frame = +1 Query: 94 KFNFFCFPNLVHLNLAQNSIHGSIPSQIGALSKLTYLDLSSNRISGPIPSQI 249 KF+F FP+L +LNL+ N G+IP QIG LSKL YLDLS N++SG IP +I Sbjct: 101 KFSFSSFPHLAYLNLSYNVFFGTIPPQIGNLSKLEYLDLSFNQLSGVIPPEI 152 >ref|XP_006371292.1| hypothetical protein POPTR_0019s08770g [Populus trichocarpa] gi|550317042|gb|ERP49089.1| hypothetical protein POPTR_0019s08770g [Populus trichocarpa] Length = 996 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/51 (58%), Positives = 37/51 (72%) Frame = +1 Query: 97 FNFFCFPNLVHLNLAQNSIHGSIPSQIGALSKLTYLDLSSNRISGPIPSQI 249 FNF FPNL L+L +NS+ G+IP + G L L+YLDLS N +SGPIPS I Sbjct: 109 FNFSSFPNLFWLDLQKNSLSGTIPREFGKLRNLSYLDLSINHLSGPIPSSI 159