BLASTX nr result
ID: Paeonia25_contig00043542
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00043542 (277 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511423.1| Spotted leaf protein, putative [Ricinus comm... 57 3e-06 ref|XP_002279989.1| PREDICTED: U-box domain-containing protein 1... 56 5e-06 ref|XP_002318035.1| hypothetical protein POPTR_0012s08030g [Popu... 55 8e-06 >ref|XP_002511423.1| Spotted leaf protein, putative [Ricinus communis] gi|223550538|gb|EEF52025.1| Spotted leaf protein, putative [Ricinus communis] Length = 682 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/45 (62%), Positives = 34/45 (75%) Frame = -3 Query: 275 SLLTDGTSHSGKKARSLLRILHKFQETSSGMVTSSLSQERFVRVW 141 SLLTDGTS +G KARSL+RI+HKF+ETSS ++ ER V VW Sbjct: 638 SLLTDGTSQAGSKARSLMRIMHKFRETSSSGSVAAAPCERPVHVW 682 >ref|XP_002279989.1| PREDICTED: U-box domain-containing protein 19-like [Vitis vinifera] Length = 679 Score = 56.2 bits (134), Expect = 5e-06 Identities = 29/45 (64%), Positives = 37/45 (82%), Gaps = 1/45 (2%) Frame = -3 Query: 275 SLLTDGTSHSGKKARSLLRILHKFQET-SSGMVTSSLSQERFVRV 144 SL+T+GTSH KKA SLL+I+HKF ET SSG+ +S + QERF+RV Sbjct: 634 SLVTEGTSHGSKKACSLLKIIHKFLETDSSGLRSSQVPQERFLRV 678 >ref|XP_002318035.1| hypothetical protein POPTR_0012s08030g [Populus trichocarpa] gi|222858708|gb|EEE96255.1| hypothetical protein POPTR_0012s08030g [Populus trichocarpa] Length = 684 Score = 55.5 bits (132), Expect = 8e-06 Identities = 30/45 (66%), Positives = 34/45 (75%), Gaps = 1/45 (2%) Frame = -3 Query: 275 SLLTDGTSHSGKKARSLLRILHKFQET-SSGMVTSSLSQERFVRV 144 SLLTDGTSH KAR+L+RILHKF ET SSGM S++ ER V V Sbjct: 639 SLLTDGTSHGSSKARALIRILHKFHETSSSGMTASAVPCERPVHV 683