BLASTX nr result
ID: Paeonia25_contig00043503
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00043503 (317 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003889256.1| hypothetical protein PGTG_22034 [Puccinia gr... 57 2e-06 >ref|XP_003889256.1| hypothetical protein PGTG_22034 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] gi|375170248|gb|EHS64077.1| hypothetical protein PGTG_22034 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] Length = 854 Score = 57.4 bits (137), Expect = 2e-06 Identities = 35/86 (40%), Positives = 44/86 (51%), Gaps = 10/86 (11%) Frame = +2 Query: 86 GDGNCGFHCIALALGMSQP-------NAWRQVRLDLLDELRCRKDWLIRHFGGTDEYDAA 244 GDGNCG+ C+A + + +P N W QVR DLL+EL K R FG +EY A Sbjct: 711 GDGNCGYSCVARHMALEKPESLYAKTNGWSQVRQDLLNELDNNKAHWTRRFGSENEYKRA 770 Query: 245 LKRLNCDKN---VPHSINGWTLSMNP 313 + L D N VP+S L M P Sbjct: 771 RESLVVDPNSTSVPYSKWMERLDMGP 796