BLASTX nr result
ID: Paeonia25_contig00043350
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00043350 (322 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EQB45493.1| hypothetical protein CGLO_15634 [Colletotrichum g... 59 5e-07 gb|EHA26206.1| hypothetical protein ASPNIDRAFT_142667 [Aspergill... 59 7e-07 ref|XP_001388624.2| hypothetical protein ANI_1_2300014 [Aspergil... 59 7e-07 emb|CAK43556.1| unnamed protein product [Aspergillus niger] 59 7e-07 ref|XP_007276993.1| het domain-containing protein [Colletotrichu... 58 2e-06 gb|EXJ69077.1| hypothetical protein A1O5_08012 [Cladophialophora... 56 4e-06 gb|EJP64401.1| HET domain-containing protein [Beauveria bassiana... 55 8e-06 >gb|EQB45493.1| hypothetical protein CGLO_15634 [Colletotrichum gloeosporioides Cg-14] Length = 566 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/51 (56%), Positives = 35/51 (68%) Frame = -3 Query: 155 MRLLNTKTKKLEDTGARVVVYAILSHRWLEEEVTFQDMTRAEVYEMKGYAK 3 MRLLN KT+KLE + YA+LSHRW EEEVT QD++ M+GYAK Sbjct: 1 MRLLNVKTRKLEQYFNNIPNYAVLSHRWGEEEVTLQDLSSPACQLMRGYAK 51 >gb|EHA26206.1| hypothetical protein ASPNIDRAFT_142667 [Aspergillus niger ATCC 1015] Length = 252 Score = 58.9 bits (141), Expect = 7e-07 Identities = 31/52 (59%), Positives = 36/52 (69%), Gaps = 1/52 (1%) Frame = -3 Query: 155 MRLLNTKTKKLED-TGARVVVYAILSHRWLEEEVTFQDMTRAEVYEMKGYAK 3 MRLLN KT KLE+ G + YAILSH W E+EV+FQDM V E +GYAK Sbjct: 1 MRLLNAKTLKLEEFVGHDIPAYAILSHTWGEDEVSFQDMQAPTVTEKRGYAK 52 >ref|XP_001388624.2| hypothetical protein ANI_1_2300014 [Aspergillus niger CBS 513.88] Length = 370 Score = 58.9 bits (141), Expect = 7e-07 Identities = 31/52 (59%), Positives = 36/52 (69%), Gaps = 1/52 (1%) Frame = -3 Query: 155 MRLLNTKTKKLED-TGARVVVYAILSHRWLEEEVTFQDMTRAEVYEMKGYAK 3 MRLLN KT KLE+ G + YAILSH W E+EV+FQDM V E +GYAK Sbjct: 1 MRLLNAKTLKLEEFVGHDIPAYAILSHTWGEDEVSFQDMQAPTVTEKRGYAK 52 >emb|CAK43556.1| unnamed protein product [Aspergillus niger] Length = 664 Score = 58.9 bits (141), Expect = 7e-07 Identities = 31/52 (59%), Positives = 36/52 (69%), Gaps = 1/52 (1%) Frame = -3 Query: 155 MRLLNTKTKKLED-TGARVVVYAILSHRWLEEEVTFQDMTRAEVYEMKGYAK 3 MRLLN KT KLE+ G + YAILSH W E+EV+FQDM V E +GYAK Sbjct: 1 MRLLNAKTLKLEEFVGHDIPAYAILSHTWGEDEVSFQDMQAPTVTEKRGYAK 52 >ref|XP_007276993.1| het domain-containing protein [Colletotrichum gloeosporioides Nara gc5] gi|429859155|gb|ELA33945.1| het domain-containing protein [Colletotrichum gloeosporioides Nara gc5] Length = 687 Score = 57.8 bits (138), Expect = 2e-06 Identities = 29/51 (56%), Positives = 34/51 (66%) Frame = -3 Query: 155 MRLLNTKTKKLEDTGARVVVYAILSHRWLEEEVTFQDMTRAEVYEMKGYAK 3 MRLLN KT+ LE + YAILSHRW EEEVT QD++ M+GYAK Sbjct: 1 MRLLNVKTRTLEQYFNNIPKYAILSHRWGEEEVTLQDLSAPAYQLMRGYAK 51 >gb|EXJ69077.1| hypothetical protein A1O5_08012 [Cladophialophora psammophila CBS 110553] Length = 632 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/52 (51%), Positives = 38/52 (73%), Gaps = 1/52 (1%) Frame = -3 Query: 155 MRLLNTKTKKLEDT-GARVVVYAILSHRWLEEEVTFQDMTRAEVYEMKGYAK 3 MRL+N +T +LE+ +R YAILSHRW +EEVTFQDM+ + + KG++K Sbjct: 1 MRLINVRTIQLEEVQSSRAPKYAILSHRWEKEEVTFQDMSSPKTFGKKGFSK 52 >gb|EJP64401.1| HET domain-containing protein [Beauveria bassiana ARSEF 2860] Length = 575 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/52 (51%), Positives = 36/52 (69%), Gaps = 1/52 (1%) Frame = -3 Query: 155 MRLLNTKTKKLEDT-GARVVVYAILSHRWLEEEVTFQDMTRAEVYEMKGYAK 3 MRLLNT T ++E+ G+ + YAILSHRWL++EV+FQD+ GYAK Sbjct: 1 MRLLNTSTLEVEEFFGSAIPEYAILSHRWLDDEVSFQDLQSGHAASKAGYAK 52