BLASTX nr result
ID: Paeonia25_contig00043222
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00043222 (591 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588283.1| Cytochrome c biogenesis [Medicago truncatula... 41 2e-09 ref|XP_003588309.1| hypothetical protein MTR_1g005780 [Medicago ... 42 6e-08 >ref|XP_003588283.1| Cytochrome c biogenesis [Medicago truncatula] gi|355477331|gb|AES58534.1| Cytochrome c biogenesis [Medicago truncatula] Length = 860 Score = 40.8 bits (94), Expect(3) = 2e-09 Identities = 20/24 (83%), Positives = 22/24 (91%) Frame = -2 Query: 266 LALSIPSGTKRKVAFISSTSVPLL 195 +ALSIPSGTKR+V ISSTSVPLL Sbjct: 321 VALSIPSGTKREVVMISSTSVPLL 344 Score = 40.4 bits (93), Expect(3) = 2e-09 Identities = 18/30 (60%), Positives = 23/30 (76%) Frame = -3 Query: 91 QKPSQAEVSTDLKGIALMLCWQIQLLGLRA 2 +KP+ + +KG+ALMLCWQ QLLGLRA Sbjct: 356 KKPAPGQGRHRMKGMALMLCWQSQLLGLRA 385 Score = 26.2 bits (56), Expect(3) = 2e-09 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -1 Query: 123 PGREHGRNGLPKSHPRP 73 PGRE G NGLPK P P Sbjct: 345 PGRERGGNGLPKK-PAP 360 >ref|XP_003588309.1| hypothetical protein MTR_1g005780 [Medicago truncatula] gi|355477357|gb|AES58560.1| hypothetical protein MTR_1g005780 [Medicago truncatula] Length = 91 Score = 42.4 bits (98), Expect(2) = 6e-08 Identities = 24/43 (55%), Positives = 27/43 (62%), Gaps = 3/43 (6%) Frame = +3 Query: 87 FWEARSYRARGPDGPPVVVG---FSCSLFNYLVMRDLLHEKRY 206 FWEARS+RA GP G P VVG F + MRDLL E+RY Sbjct: 48 FWEARSHRAHGPAGLPAVVGIIPFPGQRLGW--MRDLLREERY 88 Score = 40.8 bits (94), Expect(2) = 6e-08 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = +1 Query: 4 PATQEVGFANTTLGLSPSNLY*LRPGMAF 90 PATQEVGFANTTLG SPS PG+AF Sbjct: 20 PATQEVGFANTTLGPSPSFYADPGPGLAF 48