BLASTX nr result
ID: Paeonia25_contig00043150
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00043150 (316 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007020422.1| RING/U-box domain-containing protein isoform... 57 3e-06 ref|XP_007020421.1| RING/U-box domain-containing protein isoform... 57 3e-06 >ref|XP_007020422.1| RING/U-box domain-containing protein isoform 2 [Theobroma cacao] gi|508720050|gb|EOY11947.1| RING/U-box domain-containing protein isoform 2 [Theobroma cacao] Length = 343 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/37 (64%), Positives = 27/37 (72%) Frame = +2 Query: 2 DQIFGLPSWKYKEVDANLELDSDMDCNIVLPNEDTHC 112 DQI LPSW+YKE++ NLELD D DCN L NED C Sbjct: 261 DQISRLPSWRYKEINTNLELDHDSDCNASLANEDPEC 297 >ref|XP_007020421.1| RING/U-box domain-containing protein isoform 1 [Theobroma cacao] gi|508720049|gb|EOY11946.1| RING/U-box domain-containing protein isoform 1 [Theobroma cacao] Length = 346 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/37 (64%), Positives = 27/37 (72%) Frame = +2 Query: 2 DQIFGLPSWKYKEVDANLELDSDMDCNIVLPNEDTHC 112 DQI LPSW+YKE++ NLELD D DCN L NED C Sbjct: 264 DQISRLPSWRYKEINTNLELDHDSDCNASLANEDPEC 300