BLASTX nr result
ID: Paeonia25_contig00042471
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00042471 (281 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006370022.1| hypothetical protein POPTR_0001s38125g [Popu... 43 8e-06 >ref|XP_006370022.1| hypothetical protein POPTR_0001s38125g [Populus trichocarpa] gi|550349152|gb|ERP66591.1| hypothetical protein POPTR_0001s38125g [Populus trichocarpa] Length = 762 Score = 42.7 bits (99), Expect(2) = 8e-06 Identities = 19/31 (61%), Positives = 22/31 (70%) Frame = -3 Query: 93 KTTSSYGGCCKELQNLAVRVLSLTCSATGCE 1 K SYG C ELQ +RVLSLTCS++GCE Sbjct: 520 KWWDSYGDECPELQKFVIRVLSLTCSSSGCE 550 Score = 32.3 bits (72), Expect(2) = 8e-06 Identities = 17/38 (44%), Positives = 22/38 (57%) Frame = -1 Query: 269 FQYAKEYKADWVIKKGLITTIERMCPSMDEREKIDRQL 156 + Y +K + IK GL +ERM P+ ER KID QL Sbjct: 457 YHYNSNFKVNANIKIGLYQCLERMVPNAIERCKIDLQL 494