BLASTX nr result
ID: Paeonia25_contig00041998
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00041998 (319 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007204821.1| hypothetical protein PRUPE_ppb019012mg [Prun... 62 1e-07 ref|XP_002308031.2| hypothetical protein POPTR_0006s05010g [Popu... 61 2e-07 ref|XP_007162192.1| hypothetical protein PHAVU_001G131900g [Phas... 58 1e-06 ref|XP_007162191.1| hypothetical protein PHAVU_001G131900g [Phas... 58 1e-06 ref|XP_006484389.1| PREDICTED: DTW domain-containing protein 2-l... 56 6e-06 ref|XP_007028727.1| DTW domain-containing protein, putative [The... 56 6e-06 ref|XP_006437759.1| hypothetical protein CICLE_v10033324mg [Citr... 55 1e-05 ref|XP_002529608.1| conserved hypothetical protein [Ricinus comm... 55 1e-05 >ref|XP_007204821.1| hypothetical protein PRUPE_ppb019012mg [Prunus persica] gi|462400352|gb|EMJ06020.1| hypothetical protein PRUPE_ppb019012mg [Prunus persica] Length = 300 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/57 (50%), Positives = 36/57 (63%) Frame = -2 Query: 174 MEPDNFAHFELPDHSSTTQPPPDHRIVCTNCTRPATVCLCSTLPTDPIPTATQIIIL 4 MEP+ H + D ++ PP R +C+NCTRP VCLC +LP PI T TQIIIL Sbjct: 1 MEPEEDIH--ISDSAAADPPPRGPRPICSNCTRPGPVCLCHSLPAQPIKTQTQIIIL 55 >ref|XP_002308031.2| hypothetical protein POPTR_0006s05010g [Populus trichocarpa] gi|550335490|gb|EEE91554.2| hypothetical protein POPTR_0006s05010g [Populus trichocarpa] Length = 259 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/60 (48%), Positives = 32/60 (53%) Frame = -2 Query: 180 PHMEPDNFAHFELPDHSSTTQPPPDHRIVCTNCTRPATVCLCSTLPTDPIPTATQIIILQ 1 P EPDN PPP R +C C RP VCLC +PT PIPT TQIII+Q Sbjct: 3 PEPEPDN----------KPPSPPPKRRSICHKCDRPIPVCLCHVIPTPPIPTRTQIIIIQ 52 >ref|XP_007162192.1| hypothetical protein PHAVU_001G131900g [Phaseolus vulgaris] gi|561035656|gb|ESW34186.1| hypothetical protein PHAVU_001G131900g [Phaseolus vulgaris] Length = 246 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/39 (61%), Positives = 28/39 (71%) Frame = -2 Query: 117 PPPDHRIVCTNCTRPATVCLCSTLPTDPIPTATQIIILQ 1 P P HR +CTNC RP VCLC LP PI TAT+I+I+Q Sbjct: 12 PEPRHRSICTNCDRPTRVCLCHALPLPPIQTATRILIVQ 50 >ref|XP_007162191.1| hypothetical protein PHAVU_001G131900g [Phaseolus vulgaris] gi|561035655|gb|ESW34185.1| hypothetical protein PHAVU_001G131900g [Phaseolus vulgaris] Length = 246 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/39 (61%), Positives = 28/39 (71%) Frame = -2 Query: 117 PPPDHRIVCTNCTRPATVCLCSTLPTDPIPTATQIIILQ 1 P P HR +CTNC RP VCLC LP PI TAT+I+I+Q Sbjct: 12 PEPRHRSICTNCDRPTRVCLCHALPLPPIQTATRILIVQ 50 >ref|XP_006484389.1| PREDICTED: DTW domain-containing protein 2-like [Citrus sinensis] Length = 244 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/43 (53%), Positives = 28/43 (65%) Frame = -2 Query: 132 SSTTQPPPDHRIVCTNCTRPATVCLCSTLPTDPIPTATQIIIL 4 S + PPP R +C NC RP VCLC LPT PI T T+I+I+ Sbjct: 8 SRSNSPPPQRRRICGNCDRPQAVCLCHVLPTTPITTNTRILII 50 >ref|XP_007028727.1| DTW domain-containing protein, putative [Theobroma cacao] gi|508717332|gb|EOY09229.1| DTW domain-containing protein, putative [Theobroma cacao] Length = 255 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/57 (42%), Positives = 35/57 (61%) Frame = -2 Query: 171 EPDNFAHFELPDHSSTTQPPPDHRIVCTNCTRPATVCLCSTLPTDPIPTATQIIILQ 1 EP++ + + +S PPP R +CT C RP VCLC LPT P+ T T+I+I++ Sbjct: 3 EPEHDTNPIIATNSPPLSPPPQPRQLCTQCDRPLPVCLCHVLPTTPLQTKTKILIIR 59 >ref|XP_006437759.1| hypothetical protein CICLE_v10033324mg [Citrus clementina] gi|557539955|gb|ESR50999.1| hypothetical protein CICLE_v10033324mg [Citrus clementina] Length = 244 Score = 55.1 bits (131), Expect = 1e-05 Identities = 22/43 (51%), Positives = 28/43 (65%) Frame = -2 Query: 132 SSTTQPPPDHRIVCTNCTRPATVCLCSTLPTDPIPTATQIIIL 4 S + PPP R +C NC RP VCLC +PT PI T T+I+I+ Sbjct: 8 SRSNSPPPQRRRICGNCDRPQAVCLCHVIPTTPITTNTRILII 50 >ref|XP_002529608.1| conserved hypothetical protein [Ricinus communis] gi|223530893|gb|EEF32753.1| conserved hypothetical protein [Ricinus communis] Length = 249 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/47 (53%), Positives = 30/47 (63%) Frame = -2 Query: 141 PDHSSTTQPPPDHRIVCTNCTRPATVCLCSTLPTDPIPTATQIIILQ 1 PD S +Q P R +C NC RP VCLC +P PIPT TQI+I+Q Sbjct: 5 PDTSPPSQRP--RRSICDNCDRPLPVCLCHVIPVPPIPTTTQILIVQ 49