BLASTX nr result
ID: Paeonia25_contig00041921
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00041921 (254 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001878531.1| predicted protein [Laccaria bicolor S238N-H8... 56 6e-06 >ref|XP_001878531.1| predicted protein [Laccaria bicolor S238N-H82] gi|164646985|gb|EDR11230.1| predicted protein [Laccaria bicolor S238N-H82] Length = 727 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/74 (39%), Positives = 46/74 (62%), Gaps = 1/74 (1%) Frame = +2 Query: 2 WGEELDKL-DYFILRRAKPEVHQARPLTDRAWDQMRDGLVAFLEATKAKRLADERQELMA 178 WGEE+DKL Y + R + + LTD WD ++ +VAFLE+ KA RLA+ER+E++ Sbjct: 367 WGEEMDKLRSYELSDRLRVIENHEGVLTDEVWDNIKVPIVAFLESAKASRLANERREMLQ 426 Query: 179 TRIRQFIASVNEWY 220 R R + +++ + Sbjct: 427 RR-RSIVTDIHKTF 439