BLASTX nr result
ID: Paeonia25_contig00041858
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00041858 (650 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCM01752.1| predicted protein [Fibroporia radiculosa] 65 2e-08 ref|XP_002474027.1| predicted protein [Postia placenta Mad-698-R... 64 3e-08 ref|XP_007365023.1| Metallo-dependent hydrolase [Dichomitus squa... 61 3e-07 gb|EPS98732.1| hypothetical protein FOMPIDRAFT_85725 [Fomitopsis... 60 6e-07 ref|XP_007365024.1| Metallo-dependent hydrolase [Dichomitus squa... 59 1e-06 gb|EIW61592.1| Metallo-dependent hydrolase [Trametes versicolor ... 59 1e-06 >emb|CCM01752.1| predicted protein [Fibroporia radiculosa] Length = 478 Score = 65.1 bits (157), Expect = 2e-08 Identities = 30/54 (55%), Positives = 42/54 (77%) Frame = -2 Query: 163 SYLLKGGSVVTFIAGINEPRFYRADVLVQDSIIKEISANIQVDPDVEVIDVEGK 2 SYLLKGGS+ TF+ G ++P+ Y ADVLV+D+ I +I+ +I P+VEVID +GK Sbjct: 2 SYLLKGGSIATFVDGSSQPKCYTADVLVEDTKITQIAPDIVAGPNVEVIDCQGK 55 >ref|XP_002474027.1| predicted protein [Postia placenta Mad-698-R] gi|220726825|gb|EED80762.1| predicted protein [Postia placenta Mad-698-R] Length = 438 Score = 64.3 bits (155), Expect = 3e-08 Identities = 30/54 (55%), Positives = 40/54 (74%) Frame = -2 Query: 163 SYLLKGGSVVTFIAGINEPRFYRADVLVQDSIIKEISANIQVDPDVEVIDVEGK 2 SYLLKGG + TF AG ++P+ ++D+LV+DS I +I+ NI P VEVID EGK Sbjct: 2 SYLLKGGIIATFTAGADKPQCCKSDILVEDSTITQIAENINAGPGVEVIDCEGK 55 >ref|XP_007365023.1| Metallo-dependent hydrolase [Dichomitus squalens LYAD-421 SS1] gi|395329926|gb|EJF62311.1| Metallo-dependent hydrolase [Dichomitus squalens LYAD-421 SS1] Length = 481 Score = 61.2 bits (147), Expect = 3e-07 Identities = 29/53 (54%), Positives = 37/53 (69%) Frame = -2 Query: 160 YLLKGGSVVTFIAGINEPRFYRADVLVQDSIIKEISANIQVDPDVEVIDVEGK 2 YLLKGG+V TF+ N+P ++ADVLV+ S I +I NI PDVEVID + K Sbjct: 4 YLLKGGTVATFVQATNQPGAFKADVLVEGSTITQIKENIDAAPDVEVIDCKDK 56 >gb|EPS98732.1| hypothetical protein FOMPIDRAFT_85725 [Fomitopsis pinicola FP-58527 SS1] Length = 476 Score = 60.1 bits (144), Expect = 6e-07 Identities = 29/54 (53%), Positives = 36/54 (66%) Frame = -2 Query: 163 SYLLKGGSVVTFIAGINEPRFYRADVLVQDSIIKEISANIQVDPDVEVIDVEGK 2 +YLLKGG V TF G N P Y ADVLV+ S+I +I ++ D DVEV+D GK Sbjct: 2 TYLLKGGIVATFTKGSNNPSVYPADVLVKHSLIAQIGPDLVADSDVEVVDCSGK 55 >ref|XP_007365024.1| Metallo-dependent hydrolase [Dichomitus squalens LYAD-421 SS1] gi|395329927|gb|EJF62312.1| Metallo-dependent hydrolase [Dichomitus squalens LYAD-421 SS1] Length = 452 Score = 59.3 bits (142), Expect = 1e-06 Identities = 27/53 (50%), Positives = 37/53 (69%) Frame = -2 Query: 160 YLLKGGSVVTFIAGINEPRFYRADVLVQDSIIKEISANIQVDPDVEVIDVEGK 2 YLLKGG+V TF+ N+PR ++ADVL++ I I NI +P VEVID +G+ Sbjct: 4 YLLKGGTVATFVQATNKPRAHKADVLIEGDTIVRIEKNIDDEPGVEVIDCKGR 56 >gb|EIW61592.1| Metallo-dependent hydrolase [Trametes versicolor FP-101664 SS1] Length = 474 Score = 58.9 bits (141), Expect = 1e-06 Identities = 29/55 (52%), Positives = 37/55 (67%) Frame = -2 Query: 166 TSYLLKGGSVVTFIAGINEPRFYRADVLVQDSIIKEISANIQVDPDVEVIDVEGK 2 + YLLKGG+VVTF+ G ++PR Y+ADVLV+ + I I NI VEV D E K Sbjct: 2 SKYLLKGGTVVTFVQGESKPRVYKADVLVEGNSITRIEENITPQSGVEVFDCENK 56