BLASTX nr result
ID: Paeonia25_contig00041820
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00041820 (354 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AER13159.1| putative Ty-1 copia retrotransposon [Phaseolus vu... 62 6e-08 gb|ABO36622.1| copia LTR rider [Solanum lycopersicum] gi|1337118... 57 4e-06 gb|ABF81452.1| TIR-NBS type disease resistance protein [Populus ... 56 6e-06 >gb|AER13159.1| putative Ty-1 copia retrotransposon [Phaseolus vulgaris] Length = 867 Score = 62.4 bits (150), Expect = 6e-08 Identities = 31/65 (47%), Positives = 47/65 (72%) Frame = -2 Query: 203 DSEDDVVPTQEPP*QPSSIATDRPRRTIRKPAKYTDFVAYALSVYEEDTPNTYRKAMVSS 24 +S+++ VPTQE Q + IA R RR I+KP+++ D VAYAL V +D P+TY +A++SS Sbjct: 742 ESDEEEVPTQESQQQSAPIAVRRQRRDIQKPSRFMDMVAYALPVV-DDIPSTYPEAIMSS 800 Query: 23 DSEDW 9 +S +W Sbjct: 801 ESGNW 805 >gb|ABO36622.1| copia LTR rider [Solanum lycopersicum] gi|133711819|gb|ABO36636.1| copia LTR rider [Solanum lycopersicum] Length = 1307 Score = 56.6 bits (135), Expect = 4e-06 Identities = 37/85 (43%), Positives = 47/85 (55%), Gaps = 6/85 (7%) Frame = -2 Query: 245 NNEDSGVPINENVSDSEDDVVPTQEPP*QPSSIATDRPRRT-IRKPAKY--TDFVAYALS 75 N D P E+ + +P P SIA DRPRR +R P +Y D V YAL Sbjct: 722 NESDLKEPEEEDQEPQTETDIPESMPSDIHQSIAQDRPRRVGVRPPTRYGFEDMVGYALQ 781 Query: 74 VYEE-DT--PNTYRKAMVSSDSEDW 9 V EE DT P+TY++A++SSDSE W Sbjct: 782 VAEEVDTSEPSTYKEAILSSDSEKW 806 >gb|ABF81452.1| TIR-NBS type disease resistance protein [Populus trichocarpa] Length = 1309 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/64 (43%), Positives = 40/64 (62%) Frame = -2 Query: 218 NENVSDSEDDVVPTQEPP*QPSSIATDRPRRTIRKPAKYTDFVAYALSVYEEDTPNTYRK 39 ++ SD ED P Q SIAT +P+R I+KPA+Y + VAYAL V ++ P TY++ Sbjct: 41 SDESSDEEDATTPATT---QQESIATSKPKRVIKKPARYCNMVAYALPVIDDGIPYTYKE 97 Query: 38 AMVS 27 A+ S Sbjct: 98 AVQS 101