BLASTX nr result
ID: Paeonia25_contig00041781
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00041781 (316 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528575.1| DNA binding protein, putative [Ricinus commu... 62 8e-08 ref|XP_006481910.1| PREDICTED: uncharacterized protein LOC102617... 57 3e-06 >ref|XP_002528575.1| DNA binding protein, putative [Ricinus communis] gi|223531971|gb|EEF33783.1| DNA binding protein, putative [Ricinus communis] Length = 408 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/53 (54%), Positives = 38/53 (71%) Frame = -1 Query: 316 APLPKQVHIETGHSKGNQQSLNAMSSYSAVWNGSESTSEQRPSPDINIPALSE 158 +P+P+Q H T +S +QQ NA +S S WNGSE TS+QRPSPDIN+ L+E Sbjct: 343 SPVPEQSHGGTENSANDQQIPNATNSLSVCWNGSEPTSDQRPSPDINVSVLNE 395 >ref|XP_006481910.1| PREDICTED: uncharacterized protein LOC102617101 isoform X1 [Citrus sinensis] Length = 366 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/52 (48%), Positives = 37/52 (71%) Frame = -1 Query: 313 PLPKQVHIETGHSKGNQQSLNAMSSYSAVWNGSESTSEQRPSPDINIPALSE 158 P+P+Q E G+++ ++Q N +S SA WNGSE+T+ QRPSPDIN+ +E Sbjct: 315 PVPRQSQAEVGNAENSKQVPNPTTSQSAGWNGSETTTSQRPSPDINVSLPNE 366