BLASTX nr result
ID: Paeonia25_contig00041741
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00041741 (360 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS96307.1| hypothetical protein FOMPIDRAFT_1130608 [Fomitops... 55 8e-06 >gb|EPS96307.1| hypothetical protein FOMPIDRAFT_1130608 [Fomitopsis pinicola FP-58527 SS1] Length = 536 Score = 55.5 bits (132), Expect = 8e-06 Identities = 34/86 (39%), Positives = 43/86 (50%), Gaps = 11/86 (12%) Frame = +2 Query: 11 QLDGSSPASASVGEL----AGNDAVTPVVPPSCVSGAGDPLSA-------STALWFEDEA 157 Q + + A+ GE AGND VT P + + D SA S +WFED Sbjct: 451 QAEEEAARLATAGETGLSPAGNDEVTAAATPPGLKLSSDLPSAVDAPEMPSAMMWFEDPQ 510 Query: 158 SLGYWIGRGRAALDELGILAEHGMTR 235 + YW RGR L+E+GI AEHGM R Sbjct: 511 VVAYWATRGREVLEEMGIPAEHGMER 536