BLASTX nr result
ID: Paeonia25_contig00041589
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00041589 (346 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002282301.1| PREDICTED: pentatricopeptide repeat-containi... 83 3e-14 ref|XP_006483972.1| PREDICTED: pentatricopeptide repeat-containi... 80 3e-13 ref|XP_006438222.1| hypothetical protein CICLE_v10031251mg [Citr... 80 3e-13 ref|XP_007044848.1| Pentatricopeptide repeat superfamily protein... 79 6e-13 gb|EXB82495.1| hypothetical protein L484_027670 [Morus notabilis] 76 4e-12 ref|XP_004504137.1| PREDICTED: pentatricopeptide repeat-containi... 74 2e-11 ref|XP_006364563.1| PREDICTED: pentatricopeptide repeat-containi... 73 5e-11 ref|XP_004310156.1| PREDICTED: pentatricopeptide repeat-containi... 71 1e-10 ref|XP_007159689.1| hypothetical protein PHAVU_002G258900g [Phas... 70 3e-10 ref|XP_004240634.1| PREDICTED: pentatricopeptide repeat-containi... 70 3e-10 ref|XP_007227261.1| hypothetical protein PRUPE_ppa017811mg [Prun... 70 4e-10 gb|EYU30611.1| hypothetical protein MIMGU_mgv1a020771mg [Mimulus... 68 1e-09 ref|XP_004135492.1| PREDICTED: pentatricopeptide repeat-containi... 68 1e-09 ref|XP_002312667.1| pentatricopeptide repeat-containing family p... 66 4e-09 ref|XP_003531325.2| PREDICTED: pentatricopeptide repeat-containi... 65 7e-09 ref|XP_002530052.1| pentatricopeptide repeat-containing protein,... 65 7e-09 ref|XP_006304861.1| hypothetical protein CARUB_v10012598mg [Caps... 65 1e-08 ref|XP_006836595.1| hypothetical protein AMTR_s00131p00098210 [A... 64 2e-08 ref|XP_006417164.1| hypothetical protein EUTSA_v10007381mg [Eutr... 64 2e-08 ref|XP_002889980.1| pentatricopeptide repeat-containing protein ... 64 2e-08 >ref|XP_002282301.1| PREDICTED: pentatricopeptide repeat-containing protein At1g13040, mitochondrial [Vitis vinifera] gi|296081374|emb|CBI16807.3| unnamed protein product [Vitis vinifera] Length = 519 Score = 83.2 bits (204), Expect = 3e-14 Identities = 39/53 (73%), Positives = 45/53 (84%) Frame = -1 Query: 346 FKLIIGGLIQENKLSMACKLWDQMMEKGFTLDKAVSATLINAIHIKEPSSMNV 188 FKLIIGGLI E KLS+AC++WDQMMEKGFTLD AVS TL+NAIH + S MN+ Sbjct: 467 FKLIIGGLIWEKKLSVACRVWDQMMEKGFTLDGAVSETLVNAIHSNDASCMNI 519 >ref|XP_006483972.1| PREDICTED: pentatricopeptide repeat-containing protein At1g13040, mitochondrial-like isoform X1 [Citrus sinensis] gi|568860947|ref|XP_006483973.1| PREDICTED: pentatricopeptide repeat-containing protein At1g13040, mitochondrial-like isoform X2 [Citrus sinensis] Length = 517 Score = 80.1 bits (196), Expect = 3e-13 Identities = 35/50 (70%), Positives = 44/50 (88%) Frame = -1 Query: 346 FKLIIGGLIQENKLSMACKLWDQMMEKGFTLDKAVSATLINAIHIKEPSS 197 FKL+IGGL+QE KL +AC+LWDQMMEKGFTLDK VSA LI AIH+++ ++ Sbjct: 467 FKLLIGGLVQEKKLELACRLWDQMMEKGFTLDKTVSAALIEAIHLQDAAN 516 >ref|XP_006438222.1| hypothetical protein CICLE_v10031251mg [Citrus clementina] gi|557540418|gb|ESR51462.1| hypothetical protein CICLE_v10031251mg [Citrus clementina] Length = 517 Score = 80.1 bits (196), Expect = 3e-13 Identities = 35/50 (70%), Positives = 44/50 (88%) Frame = -1 Query: 346 FKLIIGGLIQENKLSMACKLWDQMMEKGFTLDKAVSATLINAIHIKEPSS 197 FKL+IGGL+QE KL +AC+LWDQMMEKGFTLDK VSA LI AIH+++ ++ Sbjct: 467 FKLLIGGLVQEKKLELACRLWDQMMEKGFTLDKTVSAALIEAIHLQDAAN 516 >ref|XP_007044848.1| Pentatricopeptide repeat superfamily protein isoform 1 [Theobroma cacao] gi|590695292|ref|XP_007044849.1| Pentatricopeptide repeat superfamily protein isoform 1 [Theobroma cacao] gi|590695295|ref|XP_007044850.1| Pentatricopeptide repeat superfamily protein isoform 1 [Theobroma cacao] gi|590695299|ref|XP_007044851.1| Pentatricopeptide repeat superfamily protein isoform 1 [Theobroma cacao] gi|508708783|gb|EOY00680.1| Pentatricopeptide repeat superfamily protein isoform 1 [Theobroma cacao] gi|508708784|gb|EOY00681.1| Pentatricopeptide repeat superfamily protein isoform 1 [Theobroma cacao] gi|508708785|gb|EOY00682.1| Pentatricopeptide repeat superfamily protein isoform 1 [Theobroma cacao] gi|508708786|gb|EOY00683.1| Pentatricopeptide repeat superfamily protein isoform 1 [Theobroma cacao] Length = 516 Score = 79.0 bits (193), Expect = 6e-13 Identities = 38/44 (86%), Positives = 40/44 (90%) Frame = -1 Query: 346 FKLIIGGLIQENKLSMACKLWDQMMEKGFTLDKAVSATLINAIH 215 FKLIIGGLI+E KLS ACK+WDQMMEKGFTLD AVS TLINAIH Sbjct: 468 FKLIIGGLIREKKLSKACKVWDQMMEKGFTLDGAVSETLINAIH 511 >gb|EXB82495.1| hypothetical protein L484_027670 [Morus notabilis] Length = 513 Score = 76.3 bits (186), Expect = 4e-12 Identities = 35/47 (74%), Positives = 43/47 (91%) Frame = -1 Query: 346 FKLIIGGLIQENKLSMACKLWDQMMEKGFTLDKAVSATLINAIHIKE 206 FKLIIGGLI+ENKL +AC++WDQMMEKGFTL+ A+S TLINAI+ K+ Sbjct: 467 FKLIIGGLIKENKLPLACRVWDQMMEKGFTLEPALSETLINAINSKD 513 >ref|XP_004504137.1| PREDICTED: pentatricopeptide repeat-containing protein At1g13040, mitochondrial-like [Cicer arietinum] Length = 516 Score = 73.9 bits (180), Expect = 2e-11 Identities = 32/47 (68%), Positives = 42/47 (89%) Frame = -1 Query: 346 FKLIIGGLIQENKLSMACKLWDQMMEKGFTLDKAVSATLINAIHIKE 206 FKLI+GGLI+ENK+S ACK+WDQMMEKGFTLD+ +S TL+NA+ ++ Sbjct: 468 FKLIVGGLIRENKISEACKVWDQMMEKGFTLDRRLSETLVNAMKSRD 514 >ref|XP_006364563.1| PREDICTED: pentatricopeptide repeat-containing protein At1g13040, mitochondrial-like isoform X1 [Solanum tuberosum] Length = 511 Score = 72.8 bits (177), Expect = 5e-11 Identities = 34/44 (77%), Positives = 39/44 (88%) Frame = -1 Query: 346 FKLIIGGLIQENKLSMACKLWDQMMEKGFTLDKAVSATLINAIH 215 FKLIIGGLIQE LS+AC +WDQMMEKGFTLD+ +S TLINAI+ Sbjct: 467 FKLIIGGLIQEKNLSVACAIWDQMMEKGFTLDRDLSQTLINAIN 510 >ref|XP_004310156.1| PREDICTED: pentatricopeptide repeat-containing protein At1g13040, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 516 Score = 71.2 bits (173), Expect = 1e-10 Identities = 29/47 (61%), Positives = 42/47 (89%) Frame = -1 Query: 346 FKLIIGGLIQENKLSMACKLWDQMMEKGFTLDKAVSATLINAIHIKE 206 +K++IGGLI++ +LS+AC +WD+MMEKGFTLD+ +S TLINA+H K+ Sbjct: 468 YKVVIGGLIKDKRLSVACGVWDEMMEKGFTLDRVLSETLINAVHSKD 514 >ref|XP_007159689.1| hypothetical protein PHAVU_002G258900g [Phaseolus vulgaris] gi|561033104|gb|ESW31683.1| hypothetical protein PHAVU_002G258900g [Phaseolus vulgaris] Length = 518 Score = 70.1 bits (170), Expect = 3e-10 Identities = 31/47 (65%), Positives = 40/47 (85%) Frame = -1 Query: 346 FKLIIGGLIQENKLSMACKLWDQMMEKGFTLDKAVSATLINAIHIKE 206 FKLI+GGLI+ KLS+AC++WDQMMEKG TLDK +S TL+NAI ++ Sbjct: 470 FKLIVGGLIRGKKLSLACRVWDQMMEKGLTLDKHLSETLVNAIQSRD 516 >ref|XP_004240634.1| PREDICTED: pentatricopeptide repeat-containing protein At1g13040, mitochondrial-like [Solanum lycopersicum] Length = 511 Score = 70.1 bits (170), Expect = 3e-10 Identities = 33/44 (75%), Positives = 38/44 (86%) Frame = -1 Query: 346 FKLIIGGLIQENKLSMACKLWDQMMEKGFTLDKAVSATLINAIH 215 FKLIIGGLIQ LS+AC +WDQMMEKGFTLD+ +S TLINAI+ Sbjct: 467 FKLIIGGLIQGKNLSVACAIWDQMMEKGFTLDRDLSQTLINAIN 510 >ref|XP_007227261.1| hypothetical protein PRUPE_ppa017811mg [Prunus persica] gi|462424197|gb|EMJ28460.1| hypothetical protein PRUPE_ppa017811mg [Prunus persica] Length = 541 Score = 69.7 bits (169), Expect = 4e-10 Identities = 34/56 (60%), Positives = 43/56 (76%) Frame = -1 Query: 346 FKLIIGGLIQENKLSMACKLWDQMMEKGFTLDKAVSATLINAIHIKEPSSMNVRNG 179 FKLIIGGLI+ENKLS+AC++WDQMMEKGFTLD AVS L+ + E ++ + G Sbjct: 467 FKLIIGGLIRENKLSVACRVWDQMMEKGFTLDGAVSERLMKLLLFCECQTVQMGMG 522 >gb|EYU30611.1| hypothetical protein MIMGU_mgv1a020771mg [Mimulus guttatus] Length = 515 Score = 68.2 bits (165), Expect = 1e-09 Identities = 34/49 (69%), Positives = 39/49 (79%) Frame = -1 Query: 346 FKLIIGGLIQENKLSMACKLWDQMMEKGFTLDKAVSATLINAIHIKEPS 200 FKLII GLI+E KL +AC +WDQMMEKGFTLD S TLI+AI+ KE S Sbjct: 467 FKLIIRGLIKEKKLPLACGMWDQMMEKGFTLDSYSSETLIDAINSKEVS 515 >ref|XP_004135492.1| PREDICTED: pentatricopeptide repeat-containing protein At1g13040, mitochondrial-like [Cucumis sativus] gi|449494962|ref|XP_004159696.1| PREDICTED: pentatricopeptide repeat-containing protein At1g13040, mitochondrial-like [Cucumis sativus] Length = 514 Score = 68.2 bits (165), Expect = 1e-09 Identities = 30/47 (63%), Positives = 41/47 (87%) Frame = -1 Query: 346 FKLIIGGLIQENKLSMACKLWDQMMEKGFTLDKAVSATLINAIHIKE 206 FKLIIGGL+++ +LS+AC++WDQMMEKG+TLDK +S TLI AI ++ Sbjct: 466 FKLIIGGLLRKKELSLACQVWDQMMEKGYTLDKFLSETLIKAIRSRD 512 >ref|XP_002312667.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|222852487|gb|EEE90034.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 512 Score = 66.2 bits (160), Expect = 4e-09 Identities = 29/43 (67%), Positives = 37/43 (86%) Frame = -1 Query: 346 FKLIIGGLIQENKLSMACKLWDQMMEKGFTLDKAVSATLINAI 218 +KLIIG L++ENKLS AC++WDQMME+G TLD+ +S LINAI Sbjct: 468 YKLIIGALVRENKLSDACRVWDQMMERGLTLDRGISEMLINAI 510 >ref|XP_003531325.2| PREDICTED: pentatricopeptide repeat-containing protein At1g13040, mitochondrial-like isoform X1 [Glycine max] gi|571471241|ref|XP_006585252.1| PREDICTED: pentatricopeptide repeat-containing protein At1g13040, mitochondrial-like isoform X2 [Glycine max] Length = 521 Score = 65.5 bits (158), Expect = 7e-09 Identities = 27/43 (62%), Positives = 39/43 (90%) Frame = -1 Query: 346 FKLIIGGLIQENKLSMACKLWDQMMEKGFTLDKAVSATLINAI 218 +KLI+GGLI+ K+S+AC++WDQMME+GFTL++ +S TL+NAI Sbjct: 472 YKLIVGGLIRGKKISLACRVWDQMMERGFTLNRHLSETLVNAI 514 >ref|XP_002530052.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223530468|gb|EEF32352.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 554 Score = 65.5 bits (158), Expect = 7e-09 Identities = 29/50 (58%), Positives = 40/50 (80%) Frame = -1 Query: 346 FKLIIGGLIQENKLSMACKLWDQMMEKGFTLDKAVSATLINAIHIKEPSS 197 +KLIIGGLI+E K+S+AC +W QMM+KGFTLD+A++ TLI I+ S+ Sbjct: 468 YKLIIGGLIEEKKISIACMVWGQMMDKGFTLDRAIAQTLIRGNSIENAST 517 >ref|XP_006304861.1| hypothetical protein CARUB_v10012598mg [Capsella rubella] gi|482573572|gb|EOA37759.1| hypothetical protein CARUB_v10012598mg [Capsella rubella] Length = 517 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/42 (73%), Positives = 36/42 (85%) Frame = -1 Query: 346 FKLIIGGLIQENKLSMACKLWDQMMEKGFTLDKAVSATLINA 221 FK IIGGLI+ENK+S A K+WDQMM+KGFTLD+ VS TLI A Sbjct: 468 FKFIIGGLIRENKVSAAYKVWDQMMDKGFTLDRDVSDTLIKA 509 >ref|XP_006836595.1| hypothetical protein AMTR_s00131p00098210 [Amborella trichopoda] gi|548839134|gb|ERM99448.1| hypothetical protein AMTR_s00131p00098210 [Amborella trichopoda] Length = 704 Score = 64.3 bits (155), Expect = 2e-08 Identities = 26/56 (46%), Positives = 39/56 (69%) Frame = -1 Query: 346 FKLIIGGLIQENKLSMACKLWDQMMEKGFTLDKAVSATLINAIHIKEPSSMNVRNG 179 + L+IGGL+++ KL MACK+WDQMMEKG LD V L++++ +K + V+ G Sbjct: 630 YHLLIGGLLRDEKLGMACKIWDQMMEKGLVLDTVVGEALVDSVRMKNATEKTVQRG 685 >ref|XP_006417164.1| hypothetical protein EUTSA_v10007381mg [Eutrema salsugineum] gi|557094935|gb|ESQ35517.1| hypothetical protein EUTSA_v10007381mg [Eutrema salsugineum] Length = 517 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/42 (73%), Positives = 35/42 (83%) Frame = -1 Query: 346 FKLIIGGLIQENKLSMACKLWDQMMEKGFTLDKAVSATLINA 221 FK IIGGLI+E KLS A K+WDQMM+KGFTLD+ VS TLI A Sbjct: 468 FKFIIGGLIREKKLSAAYKVWDQMMDKGFTLDRDVSDTLIKA 509 >ref|XP_002889980.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297335822|gb|EFH66239.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 517 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/42 (73%), Positives = 35/42 (83%) Frame = -1 Query: 346 FKLIIGGLIQENKLSMACKLWDQMMEKGFTLDKAVSATLINA 221 FK IIGGLI+E KLS A K+WDQMM+KGFTLD+ VS TLI A Sbjct: 468 FKFIIGGLIREKKLSAAYKVWDQMMDKGFTLDRDVSDTLIKA 509