BLASTX nr result
ID: Paeonia25_contig00040907
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00040907 (502 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_003407539.1| hypothetical protein Gobs_0374 [Geodermatoph... 56 6e-06 >ref|YP_003407539.1| hypothetical protein Gobs_0374 [Geodermatophilus obscurus DSM 43160] gi|502711485|ref|WP_012946609.1| hypothetical protein [Geodermatophilus obscurus] gi|284062230|gb|ADB73168.1| hypothetical protein Gobs_0374 [Geodermatophilus obscurus DSM 43160] Length = 738 Score = 55.8 bits (133), Expect = 6e-06 Identities = 47/155 (30%), Positives = 65/155 (41%), Gaps = 6/155 (3%) Frame = +2 Query: 44 ADDRRAPASGPDERGGSRIAQPASSSEFPRTEVRTSRPSTAEDHKHVRPPALGDDRTSRP 223 A+DR AP + P G R A PA P E R ++P+T RP +DR Sbjct: 266 AEDRPAPPAKPATPAGDRPAPPAEDRPAPPAEDRPAKPATPAGD---RPAPPAEDR---- 318 Query: 224 APAPPVQARLSTASSASSNKP----EDRPGSGGQALQSSRLDPRLGPPAS-GHPLG-YPL 385 PAPP + R + ++ + ++P EDRP + + R PPA P G P Sbjct: 319 -PAPPAEDRPAKPATPAGDRPAPPAEDRPAPPAGDRPAPPAEDRPAPPAKPATPAGDRPA 377 Query: 386 ESGQSAMQEHLSEAPTATDLRSAPADERASRPSVP 490 + A AP A D + PA RP+ P Sbjct: 378 PPAKPATPAGDRPAPPAEDRPAKPATPAGDRPAPP 412