BLASTX nr result
ID: Paeonia25_contig00040905
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00040905 (250 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAO20284.1| polyketide synthase 1 [Grifola frondosa] 92 7e-17 ref|XP_007398509.1| hypothetical protein PHACADRAFT_198250 [Phan... 92 7e-17 emb|CCM00101.1| predicted protein [Fibroporia radiculosa] 72 8e-11 gb|EIW56045.1| ketoacyl-synt-domain-containing protein [Trametes... 68 1e-09 ref|XP_007262597.1| polyketide synthase [Fomitiporia mediterrane... 63 4e-08 gb|EJP62792.1| polyketide synthase [Beauveria bassiana ARSEF 2860] 61 1e-07 gb|EMD42363.1| hypothetical protein CERSUDRAFT_128472 [Ceriporio... 59 7e-07 emb|CCX04910.1| Similar to Conidial yellow pigment biosynthesis ... 57 3e-06 ref|XP_007307184.1| polyketide synthase [Stereum hirsutum FP-916... 57 3e-06 gb|ESK95806.1| polyketide synthase [Moniliophthora roreri MCA 2997] 56 4e-06 dbj|BAE59374.1| unnamed protein product [Aspergillus oryzae RIB40] 56 6e-06 gb|EIT78482.1| polyketide synthase module [Aspergillus oryzae 3.... 56 6e-06 ref|XP_001821376.2| polyketide synthase [Aspergillus oryzae RIB40] 56 6e-06 ref|XP_002377153.1| polyketide synthase, putative [Aspergillus f... 56 6e-06 >dbj|BAO20284.1| polyketide synthase 1 [Grifola frondosa] Length = 2103 Score = 92.0 bits (227), Expect = 7e-17 Identities = 43/81 (53%), Positives = 60/81 (74%) Frame = +2 Query: 8 LIAGHLVAGYALCPASVYHEMAIAAAHYLLEDLGKLDSESVLDLSEIVYSNPLVYNAEVR 187 L+ GH V+G+ALCPASVYHE+A A A +LE L ++ +++VLDL+ I YSNPLVY+ +V Sbjct: 1331 LVEGHKVSGFALCPASVYHELAAAGAQLVLEQLARMPADAVLDLAGITYSNPLVYSPDVA 1390 Query: 188 KTIRVEITAFDGEEKHSGKFS 250 +T+R +IT EK+ G FS Sbjct: 1391 RTVRTDITLNAPGEKYVGAFS 1411 >ref|XP_007398509.1| hypothetical protein PHACADRAFT_198250 [Phanerochaete carnosa HHB-10118-sp] gi|409044350|gb|EKM53832.1| hypothetical protein PHACADRAFT_198250 [Phanerochaete carnosa HHB-10118-sp] Length = 1806 Score = 92.0 bits (227), Expect = 7e-17 Identities = 47/83 (56%), Positives = 61/83 (73%) Frame = +2 Query: 2 SHLIAGHLVAGYALCPASVYHEMAIAAAHYLLEDLGKLDSESVLDLSEIVYSNPLVYNAE 181 ++LI GH VAG+ALCPASV+ EMA AAA +LE+ + S+S + LSEI +SNPLVY Sbjct: 1355 AYLIEGHQVAGHALCPASVFIEMASAAAQLVLEEHRRFTSDSTISLSEIAFSNPLVYFPN 1414 Query: 182 VRKTIRVEITAFDGEEKHSGKFS 250 V +TIRVEIT +KH+G+FS Sbjct: 1415 VPRTIRVEITLAGPGDKHTGRFS 1437 >emb|CCM00101.1| predicted protein [Fibroporia radiculosa] Length = 1996 Score = 72.0 bits (175), Expect = 8e-11 Identities = 36/79 (45%), Positives = 55/79 (69%) Frame = +2 Query: 11 IAGHLVAGYALCPASVYHEMAIAAAHYLLEDLGKLDSESVLDLSEIVYSNPLVYNAEVRK 190 I+GH VAGYALCPAS+++E+A+A+AH L D LD+ +L ++V+ NPLVY R+ Sbjct: 1253 ISGHEVAGYALCPASLHYELALASAHNFLADTQNLDTLMCPELLDVVHDNPLVYAPWRRQ 1312 Query: 191 TIRVEITAFDGEEKHSGKF 247 +IRV+I + ++ S +F Sbjct: 1313 SIRVDIQSNAQSQRSSMQF 1331 >gb|EIW56045.1| ketoacyl-synt-domain-containing protein [Trametes versicolor FP-101664 SS1] Length = 1768 Score = 68.2 bits (165), Expect = 1e-09 Identities = 39/83 (46%), Positives = 46/83 (55%) Frame = +2 Query: 2 SHLIAGHLVAGYALCPASVYHEMAIAAAHYLLEDLGKLDSESVLDLSEIVYSNPLVYNAE 181 S LI GH V LCPASVY E+A + A +L+D VLDLSE+VY PLVY Sbjct: 922 SELIQGHKVGDVPLCPASVYVELATSVAISVLQDRHAWAEGDVLDLSEVVYPRPLVYTPR 981 Query: 182 VRKTIRVEITAFDGEEKHSGKFS 250 I VE++ EKH G FS Sbjct: 982 SNDRIHVEVSLL---EKHKGSFS 1001 >ref|XP_007262597.1| polyketide synthase [Fomitiporia mediterranea MF3/22] gi|393220848|gb|EJD06333.1| polyketide synthase [Fomitiporia mediterranea MF3/22] Length = 2269 Score = 63.2 bits (152), Expect = 4e-08 Identities = 34/80 (42%), Positives = 49/80 (61%) Frame = +2 Query: 11 IAGHLVAGYALCPASVYHEMAIAAAHYLLEDLGKLDSESVLDLSEIVYSNPLVYNAEVRK 190 I GH VA LCPASVYHE+A++AA LE + + +++ L LSE+ ++ PLVY++ Sbjct: 1452 ITGHRVASSPLCPASVYHELALSAATCTLEHIDEAFTDA-LTLSEVQFTLPLVYDSAKPV 1510 Query: 191 TIRVEITAFDGEEKHSGKFS 250 +R I KH+G FS Sbjct: 1511 VVRTSINLHPNGGKHAGTFS 1530 >gb|EJP62792.1| polyketide synthase [Beauveria bassiana ARSEF 2860] Length = 2211 Score = 61.2 bits (147), Expect = 1e-07 Identities = 33/67 (49%), Positives = 41/67 (61%) Frame = +2 Query: 11 IAGHLVAGYALCPASVYHEMAIAAAHYLLEDLGKLDSESVLDLSEIVYSNPLVYNAEVRK 190 I GHLV GYALCPASVYHEM +AA + G S V LS++ Y P+VY+ + Sbjct: 1336 IEGHLVCGYALCPASVYHEMVLAALNDCQSAAG---SSVVWGLSKVSYCAPMVYDGNSNQ 1392 Query: 191 TIRVEIT 211 +RV IT Sbjct: 1393 VLRVVIT 1399 >gb|EMD42363.1| hypothetical protein CERSUDRAFT_128472 [Ceriporiopsis subvermispora B] Length = 1979 Score = 58.9 bits (141), Expect = 7e-07 Identities = 29/71 (40%), Positives = 47/71 (66%) Frame = +2 Query: 8 LIAGHLVAGYALCPASVYHEMAIAAAHYLLEDLGKLDSESVLDLSEIVYSNPLVYNAEVR 187 LI GH VAG +LCPASVY E+A+ A LL + ++ V++ +++VY++PLV + + Sbjct: 1280 LIEGHRVAGSSLCPASVYLELALQALSALLRHVHYSRTDLVVEAADVVYTSPLVLHRDAD 1339 Query: 188 KTIRVEITAFD 220 + ++ EIT D Sbjct: 1340 QIVQTEITIAD 1350 >emb|CCX04910.1| Similar to Conidial yellow pigment biosynthesis polyketide synthase; acc. no. Q03149 [Pyronema omphalodes CBS 100304] Length = 2087 Score = 57.0 bits (136), Expect = 3e-06 Identities = 33/68 (48%), Positives = 42/68 (61%), Gaps = 1/68 (1%) Frame = +2 Query: 2 SHLIAGHLVAGYALCPASVYHEMAIAAAHYLLEDLGKLDSESVLDLSEIVYSNPLVYNAE 181 S LI GHLV G ALCPASVYHE+A AA + G + L++I Y+NPLVY+A Sbjct: 1310 STLIKGHLVGGSALCPASVYHELAYEAAFL---EFGFTGENQLPILTDIDYANPLVYDAS 1366 Query: 182 V-RKTIRV 202 KT+ + Sbjct: 1367 ACDKTVEI 1374 >ref|XP_007307184.1| polyketide synthase [Stereum hirsutum FP-91666 SS1] gi|389742941|gb|EIM84127.1| polyketide synthase [Stereum hirsutum FP-91666 SS1] Length = 2220 Score = 56.6 bits (135), Expect = 3e-06 Identities = 31/80 (38%), Positives = 43/80 (53%) Frame = +2 Query: 11 IAGHLVAGYALCPASVYHEMAIAAAHYLLEDLGKLDSESVLDLSEIVYSNPLVYNAEVRK 190 I GH V G+ALCPASVYHE+A+A E L +S + L + Y+ PLVY + Sbjct: 1340 IVGHKVGGHALCPASVYHELALAGVESAKEHLQARFPDSYIALRAVDYAKPLVYVEGEER 1399 Query: 191 TIRVEITAFDGEEKHSGKFS 250 ++ +T E+ G FS Sbjct: 1400 VVKTTVTL---EKDGKGVFS 1416 >gb|ESK95806.1| polyketide synthase [Moniliophthora roreri MCA 2997] Length = 2020 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/74 (36%), Positives = 45/74 (60%) Frame = +2 Query: 2 SHLIAGHLVAGYALCPASVYHEMAIAAAHYLLEDLGKLDSESVLDLSEIVYSNPLVYNAE 181 S I GH V + LCPASVY E+ +A H + + ++ES + + ++ ++NPLV++ + Sbjct: 1316 SDFITGHRVGKFPLCPASVYVELLLAGVHTIQKLKQNYNTESHVSIDDLQFNNPLVHDPD 1375 Query: 182 VRKTIRVEITAFDG 223 V +TI I+ DG Sbjct: 1376 VPRTITTRISWDDG 1389 >dbj|BAE59374.1| unnamed protein product [Aspergillus oryzae RIB40] Length = 2135 Score = 55.8 bits (133), Expect = 6e-06 Identities = 32/80 (40%), Positives = 47/80 (58%) Frame = +2 Query: 11 IAGHLVAGYALCPASVYHEMAIAAAHYLLEDLGKLDSESVLDLSEIVYSNPLVYNAEVRK 190 I GH V ALCPASVYHE+ +AA+ ++ D G+ E+ LS ++Y PL+Y+ E Sbjct: 1314 ILGHRVCEQALCPASVYHEIVLAASKWIQRDPGE---EATRALSNVLYPAPLLYSEESSA 1370 Query: 191 TIRVEITAFDGEEKHSGKFS 250 +RV I G+ K + F+ Sbjct: 1371 IVRVYIKP-GGDHKTNYSFT 1389 >gb|EIT78482.1| polyketide synthase module [Aspergillus oryzae 3.042] Length = 2135 Score = 55.8 bits (133), Expect = 6e-06 Identities = 32/80 (40%), Positives = 47/80 (58%) Frame = +2 Query: 11 IAGHLVAGYALCPASVYHEMAIAAAHYLLEDLGKLDSESVLDLSEIVYSNPLVYNAEVRK 190 I GH V ALCPASVYHE+ +AA+ ++ D G+ E+ LS ++Y PL+Y+ E Sbjct: 1314 ILGHRVCEQALCPASVYHEIVLAASKWIQRDPGE---EATRALSNVLYPAPLLYSEESSA 1370 Query: 191 TIRVEITAFDGEEKHSGKFS 250 +RV I G+ K + F+ Sbjct: 1371 IVRVYIKP-GGDHKTNYSFT 1389 >ref|XP_001821376.2| polyketide synthase [Aspergillus oryzae RIB40] Length = 1895 Score = 55.8 bits (133), Expect = 6e-06 Identities = 32/80 (40%), Positives = 47/80 (58%) Frame = +2 Query: 11 IAGHLVAGYALCPASVYHEMAIAAAHYLLEDLGKLDSESVLDLSEIVYSNPLVYNAEVRK 190 I GH V ALCPASVYHE+ +AA+ ++ D G+ E+ LS ++Y PL+Y+ E Sbjct: 1152 ILGHRVCEQALCPASVYHEIVLAASKWIQRDPGE---EATRALSNVLYPAPLLYSEESSA 1208 Query: 191 TIRVEITAFDGEEKHSGKFS 250 +RV I G+ K + F+ Sbjct: 1209 IVRVYIKP-GGDHKTNYSFT 1227 >ref|XP_002377153.1| polyketide synthase, putative [Aspergillus flavus NRRL3357] gi|220697566|gb|EED53907.1| polyketide synthase, putative [Aspergillus flavus NRRL3357] Length = 2137 Score = 55.8 bits (133), Expect = 6e-06 Identities = 32/80 (40%), Positives = 47/80 (58%) Frame = +2 Query: 11 IAGHLVAGYALCPASVYHEMAIAAAHYLLEDLGKLDSESVLDLSEIVYSNPLVYNAEVRK 190 I GH V ALCPASVYHE+ +AA+ ++ D G+ E+ LS ++Y PL+Y+ E Sbjct: 1317 ILGHRVCEQALCPASVYHEIVLAASKWIQRDPGE---EATRALSNVLYPAPLLYSEESSA 1373 Query: 191 TIRVEITAFDGEEKHSGKFS 250 +RV I G+ K + F+ Sbjct: 1374 IVRVYIKP-GGDHKTNYSFT 1392