BLASTX nr result
ID: Paeonia25_contig00040887
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00040887 (617 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007268632.1| hypothetical protein FOMMEDRAFT_169493 [Fomi... 57 4e-06 >ref|XP_007268632.1| hypothetical protein FOMMEDRAFT_169493 [Fomitiporia mediterranea MF3/22] gi|393215864|gb|EJD01355.1| hypothetical protein FOMMEDRAFT_169493 [Fomitiporia mediterranea MF3/22] Length = 829 Score = 57.0 bits (136), Expect = 4e-06 Identities = 29/87 (33%), Positives = 52/87 (59%), Gaps = 2/87 (2%) Frame = +1 Query: 232 LERTLSMEERETFLGELAHASL--AASVFSLDIQQTEAVQQTARKIGLYVCAVKPKSPTK 405 LERT S+ ERE F +L S A VF++D+++ ++Q AR++ + + P+ Sbjct: 212 LERTSSVTEREQFFSQLVQKSKKPIAGVFTIDMKEIRELEQHARRLNFHARVIAPEYADG 271 Query: 406 NGRMCWLVLGNNEEAVKRLAATLDGGV 486 + WLV+G +E++VK+L + ++G V Sbjct: 272 TTGLGWLVVGKDEDSVKKLFSEVEGDV 298