BLASTX nr result
ID: Paeonia25_contig00040859
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00040859 (379 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007211670.1| hypothetical protein PRUPE_ppa009086mg [Prun... 60 2e-07 >ref|XP_007211670.1| hypothetical protein PRUPE_ppa009086mg [Prunus persica] gi|462407535|gb|EMJ12869.1| hypothetical protein PRUPE_ppa009086mg [Prunus persica] Length = 307 Score = 60.5 bits (145), Expect = 2e-07 Identities = 34/60 (56%), Positives = 37/60 (61%), Gaps = 2/60 (3%) Frame = +1 Query: 1 GSYKRTINSVPAPK--GLEDFGKKRSIGFEPEREVAYNCRGDFASKSSLRVGHLAAVLAG 174 GSYKRT N+VPA + E G KRS GFE AY CR FASK+ LRVGHL A G Sbjct: 247 GSYKRTTNAVPAKELEHNESVGLKRSTGFEALTTKAYYCRDAFASKNGLRVGHLTAAFQG 306