BLASTX nr result
ID: Paeonia25_contig00040816
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00040816 (241 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCM05152.1| predicted protein [Fibroporia radiculosa] 61 1e-07 gb|EIW64399.1| hypothetical protein TRAVEDRAFT_68214 [Trametes v... 59 9e-07 gb|EMD42224.1| hypothetical protein CERSUDRAFT_110758 [Ceriporio... 58 1e-06 ref|XP_007360474.1| hypothetical protein DICSQDRAFT_176739 [Dich... 57 3e-06 gb|EPT03937.1| hypothetical protein FOMPIDRAFT_1114654 [Fomitops... 56 5e-06 ref|XP_007298371.1| hypothetical protein STEHIDRAFT_90346 [Stere... 56 5e-06 >emb|CCM05152.1| predicted protein [Fibroporia radiculosa] Length = 745 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/50 (58%), Positives = 38/50 (76%) Frame = -1 Query: 178 SLQLDRVSTYVVQLLRGEARSGPANTSLARPISVTAYTLLLPTLWSLVCS 29 ++Q+ RVS YV+Q LRGE +G + TSLARPI+ T Y LLPT+WSL+ S Sbjct: 505 TVQVSRVSEYVIQTLRGEVPAGASQTSLARPITPTIYLALLPTIWSLLNS 554 >gb|EIW64399.1| hypothetical protein TRAVEDRAFT_68214 [Trametes versicolor FP-101664 SS1] Length = 768 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/46 (58%), Positives = 34/46 (73%) Frame = -1 Query: 172 QLDRVSTYVVQLLRGEARSGPANTSLARPISVTAYTLLLPTLWSLV 35 Q++RVS Y+VQLL GEA S A +S+ RPI AY LLPT+WSL+ Sbjct: 524 QIERVSKYIVQLLHGEAPSSSAQSSIPRPIVAQAYVSLLPTIWSLI 569 >gb|EMD42224.1| hypothetical protein CERSUDRAFT_110758 [Ceriporiopsis subvermispora B] Length = 762 Score = 58.2 bits (139), Expect = 1e-06 Identities = 30/64 (46%), Positives = 43/64 (67%), Gaps = 2/64 (3%) Frame = -1 Query: 190 AASLSLQLDRVSTYVVQLLRGEARSGPANTSLARPISVTAYTLLLPTLWSLVCSD--AQD 17 A++ L + RVS YVV+++RGE G + T+L+R I+ + YT LLPT+WSL+ S A Sbjct: 517 ASASDLHVSRVSEYVVRIIRGEPLPGASQTTLSRSITPSTYTALLPTIWSLISSPPRAHA 576 Query: 16 EDGT 5 ED T Sbjct: 577 EDDT 580 >ref|XP_007360474.1| hypothetical protein DICSQDRAFT_176739 [Dichomitus squalens LYAD-421 SS1] gi|395334650|gb|EJF67026.1| hypothetical protein DICSQDRAFT_176739 [Dichomitus squalens LYAD-421 SS1] Length = 758 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/52 (51%), Positives = 36/52 (69%) Frame = -1 Query: 172 QLDRVSTYVVQLLRGEARSGPANTSLARPISVTAYTLLLPTLWSLVCSDAQD 17 Q++RVS Y+ QLLRG+A + + +L RPI+ AY LLPT+WSLV S D Sbjct: 522 QIERVSVYITQLLRGQASTSSSQITLPRPITPQAYIALLPTIWSLVNSRHSD 573 >gb|EPT03937.1| hypothetical protein FOMPIDRAFT_1114654 [Fomitopsis pinicola FP-58527 SS1] Length = 745 Score = 56.2 bits (134), Expect = 5e-06 Identities = 29/55 (52%), Positives = 40/55 (72%) Frame = -1 Query: 190 AASLSLQLDRVSTYVVQLLRGEARSGPANTSLARPISVTAYTLLLPTLWSLVCSD 26 A + +LQ+ RVS YV+ LLRGE +G A LARP++ AY+ LLPT+WSL+ S+ Sbjct: 507 APAQALQVARVSEYVMHLLRGETSTGSA---LARPVAPAAYSALLPTIWSLLSSE 558 >ref|XP_007298371.1| hypothetical protein STEHIDRAFT_90346 [Stereum hirsutum FP-91666 SS1] gi|389751883|gb|EIM92956.1| hypothetical protein STEHIDRAFT_90346 [Stereum hirsutum FP-91666 SS1] Length = 762 Score = 56.2 bits (134), Expect = 5e-06 Identities = 34/70 (48%), Positives = 41/70 (58%), Gaps = 8/70 (11%) Frame = -1 Query: 187 ASLSLQLDRVSTYVVQLLRGEARSGPANTSLARPISVTAYTLLLPTLWSLVCSDAQ---- 20 A+LSLQL VS YVV LL GE S N +L R IS AY L+PT+WSL+ + + Sbjct: 502 ATLSLQLSHVSNYVVHLLSGEPSSSQPN-ALCRHISTQAYIALMPTIWSLINNPSNGVAV 560 Query: 19 ----DEDGTD 2 DEDG D Sbjct: 561 PNGIDEDGDD 570