BLASTX nr result
ID: Paeonia25_contig00040803
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00040803 (299 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPT05655.1| hypothetical protein FOMPIDRAFT_1021408 [Fomitops... 57 4e-06 >gb|EPT05655.1| hypothetical protein FOMPIDRAFT_1021408 [Fomitopsis pinicola FP-58527 SS1] Length = 390 Score = 56.6 bits (135), Expect = 4e-06 Identities = 23/34 (67%), Positives = 30/34 (88%) Frame = -1 Query: 167 SAHPQRYYINPNDTLLGIALKYKLDGRALCRINN 66 S+ PQRYYI PNDTL+GIAL++ +DGR LCR+N+ Sbjct: 191 SSTPQRYYIQPNDTLIGIALRFHVDGRTLCRLND 224