BLASTX nr result
ID: Paeonia25_contig00040744
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00040744 (544 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513167.1| Anthocyanin 5-aromatic acyltransferase, puta... 54 1e-07 >ref|XP_002513167.1| Anthocyanin 5-aromatic acyltransferase, putative [Ricinus communis] gi|223547665|gb|EEF49158.1| Anthocyanin 5-aromatic acyltransferase, putative [Ricinus communis] Length = 464 Score = 53.9 bits (128), Expect(2) = 1e-07 Identities = 34/79 (43%), Positives = 46/79 (58%), Gaps = 11/79 (13%) Frame = -3 Query: 371 PSCSVSHATIFPLTFFNIP*LLFTSN*PL------DSTTFFTFTILPNLKHPLSHTVQEF 210 PS + S +T PLTFF++P L F+ PL ST+ F + LPNLKH LS +QEF Sbjct: 17 PSPNSSPSTTLPLTFFDLPWLFFSPCQPLFFYAYPHSTSHFLSSTLPNLKHSLSLALQEF 76 Query: 209 -----NALISYFNSPPKPR 168 N ++S F+S KP+ Sbjct: 77 FPFLGNLVVSSFDSNKKPK 95 Score = 27.7 bits (60), Expect(2) = 1e-07 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -2 Query: 420 APPFTIKLLEHSQISP 373 A P TIK+LEHS+ISP Sbjct: 2 AKPSTIKVLEHSKISP 17