BLASTX nr result
ID: Paeonia25_contig00040663
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00040663 (307 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007366143.1| Brix-domain-containing protein [Dichomitus s... 79 9e-13 gb|EIW61267.1| Brix-domain-containing protein [Trametes versicol... 77 2e-12 emb|CCM04812.1| predicted protein [Fibroporia radiculosa] 70 3e-10 gb|ETW84394.1| hypothetical protein HETIRDRAFT_313499 [Heterobas... 65 7e-09 gb|EPT02737.1| hypothetical protein FOMPIDRAFT_1047474 [Fomitops... 65 1e-08 gb|EPQ59305.1| Brix-domain-containing protein [Gloeophyllum trab... 63 4e-08 ref|XP_002911179.1| brix domain-containing protein [Coprinopsis ... 62 6e-08 ref|XP_001876631.1| predicted protein [Laccaria bicolor S238N-H8... 62 1e-07 gb|ESK97649.1| putative imp4-component of the u3 small nucleolar... 60 3e-07 ref|XP_007382239.1| Brix-domain-containing protein [Punctularia ... 59 7e-07 ref|XP_007303130.1| Brix-domain-containing protein [Stereum hirs... 57 2e-06 ref|XP_007315698.1| hypothetical protein SERLADRAFT_461381 [Serp... 57 2e-06 ref|XP_006460009.1| hypothetical protein AGABI2DRAFT_67378, part... 57 3e-06 ref|XP_003036670.1| hypothetical protein SCHCODRAFT_46039 [Schiz... 57 3e-06 ref|XP_007268258.1| Brix-domain-containing protein [Fomitiporia ... 56 6e-06 >ref|XP_007366143.1| Brix-domain-containing protein [Dichomitus squalens LYAD-421 SS1] gi|395328924|gb|EJF61314.1| Brix-domain-containing protein [Dichomitus squalens LYAD-421 SS1] Length = 312 Score = 78.6 bits (192), Expect = 9e-13 Identities = 37/42 (88%), Positives = 39/42 (92%) Frame = -1 Query: 307 IRQGTIEQAEADREWVLAHYSRTAKKRSLLAGPAPRPSAPTE 182 IRQGTIEQ EA+REWVLAHYSRTAKKRSLL+GPAPRPSA E Sbjct: 259 IRQGTIEQTEAEREWVLAHYSRTAKKRSLLSGPAPRPSATAE 300 >gb|EIW61267.1| Brix-domain-containing protein [Trametes versicolor FP-101664 SS1] Length = 316 Score = 77.0 bits (188), Expect = 2e-12 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -1 Query: 307 IRQGTIEQAEADREWVLAHYSRTAKKRSLLAGPAPRPSA 191 IRQGTIEQ EA+REWVLAHYSRTAKKRSLL+GPAPRPSA Sbjct: 259 IRQGTIEQTEAEREWVLAHYSRTAKKRSLLSGPAPRPSA 297 >emb|CCM04812.1| predicted protein [Fibroporia radiculosa] Length = 355 Score = 70.1 bits (170), Expect = 3e-10 Identities = 32/43 (74%), Positives = 37/43 (86%) Frame = -1 Query: 307 IRQGTIEQAEADREWVLAHYSRTAKKRSLLAGPAPRPSAPTEQ 179 IRQGTIEQ EA+REWVLAHYSRTAKKRSLL GP+ RP + ++ Sbjct: 301 IRQGTIEQTEAEREWVLAHYSRTAKKRSLLTGPSSRPVSTVQE 343 >gb|ETW84394.1| hypothetical protein HETIRDRAFT_313499 [Heterobasidion irregulare TC 32-1] Length = 322 Score = 65.5 bits (158), Expect = 7e-09 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = -1 Query: 307 IRQGTIEQAEADREWVLAHYSRTAKKRSLLAGPAPRPS 194 IRQGTIEQ EA+REWVL+HYSRTAKKRS+L+GP PS Sbjct: 268 IRQGTIEQTEAEREWVLSHYSRTAKKRSVLSGPYTMPS 305 >gb|EPT02737.1| hypothetical protein FOMPIDRAFT_1047474 [Fomitopsis pinicola FP-58527 SS1] Length = 393 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -1 Query: 307 IRQGTIEQAEADREWVLAHYSRTAKKRSLLAGPA 206 IRQGTIEQ EA+REWVLAHYSRTAKKRSLL GP+ Sbjct: 341 IRQGTIEQTEAEREWVLAHYSRTAKKRSLLTGPS 374 >gb|EPQ59305.1| Brix-domain-containing protein [Gloeophyllum trabeum ATCC 11539] Length = 306 Score = 63.2 bits (152), Expect = 4e-08 Identities = 31/43 (72%), Positives = 36/43 (83%) Frame = -1 Query: 307 IRQGTIEQAEADREWVLAHYSRTAKKRSLLAGPAPRPSAPTEQ 179 IR GTIEQ EA+REWVLAHY+RTAKKR+LL+GP RP+ EQ Sbjct: 258 IRLGTIEQTEAEREWVLAHYARTAKKRTLLSGPG-RPAESEEQ 299 >ref|XP_002911179.1| brix domain-containing protein [Coprinopsis cinerea okayama7#130] gi|298407549|gb|EFI27685.1| brix domain-containing protein [Coprinopsis cinerea okayama7#130] Length = 202 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/43 (65%), Positives = 36/43 (83%) Frame = -1 Query: 307 IRQGTIEQAEADREWVLAHYSRTAKKRSLLAGPAPRPSAPTEQ 179 IRQGTIEQ EA++EWVL+HY+RTAKKRS+LAGP P+++ Sbjct: 156 IRQGTIEQTEAEKEWVLSHYTRTAKKRSVLAGPTFAVEPPSKR 198 >ref|XP_001876631.1| predicted protein [Laccaria bicolor S238N-H82] gi|164648124|gb|EDR12367.1| predicted protein [Laccaria bicolor S238N-H82] Length = 303 Score = 61.6 bits (148), Expect = 1e-07 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -1 Query: 307 IRQGTIEQAEADREWVLAHYSRTAKKRSLLAGPAPRPSAP 188 IRQGTIEQ EA+REWVL HY+RTAKKRS+L+G PR S P Sbjct: 258 IRQGTIEQTEAEREWVLTHYTRTAKKRSVLSG--PRSSEP 295 >gb|ESK97649.1| putative imp4-component of the u3 small nucleolar ribonucleoprotein [Moniliophthora roreri MCA 2997] Length = 310 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/42 (71%), Positives = 35/42 (83%), Gaps = 4/42 (9%) Frame = -1 Query: 307 IRQGTIEQAEADREWVLAHYSRTAKKRSLLAG----PAPRPS 194 IRQGT+EQ EA+REWVL+HYSRTAKKR+LL+G APR S Sbjct: 258 IRQGTLEQTEAEREWVLSHYSRTAKKRNLLSGSGLYSAPRHS 299 >ref|XP_007382239.1| Brix-domain-containing protein [Punctularia strigosozonata HHB-11173 SS5] gi|390601333|gb|EIN10727.1| Brix-domain-containing protein [Punctularia strigosozonata HHB-11173 SS5] Length = 304 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -1 Query: 307 IRQGTIEQAEADREWVLAHYSRTAKKRSLL 218 IRQGTIEQ EADREWVLAHYSRTAKKR LL Sbjct: 258 IRQGTIEQKEADREWVLAHYSRTAKKRRLL 287 >ref|XP_007303130.1| Brix-domain-containing protein [Stereum hirsutum FP-91666 SS1] gi|389747395|gb|EIM88574.1| Brix-domain-containing protein [Stereum hirsutum FP-91666 SS1] Length = 315 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -1 Query: 307 IRQGTIEQAEADREWVLAHYSRTAKKRSLLAGP 209 IRQGTIEQ+EA+REWVL+ YSRTAKKRSLL+ P Sbjct: 259 IRQGTIEQSEAEREWVLSTYSRTAKKRSLLSTP 291 >ref|XP_007315698.1| hypothetical protein SERLADRAFT_461381 [Serpula lacrymans var. lacrymans S7.9] gi|336373645|gb|EGO01983.1| hypothetical protein SERLA73DRAFT_120635 [Serpula lacrymans var. lacrymans S7.3] gi|336386461|gb|EGO27607.1| hypothetical protein SERLADRAFT_461381 [Serpula lacrymans var. lacrymans S7.9] Length = 288 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/31 (80%), Positives = 31/31 (100%) Frame = -1 Query: 307 IRQGTIEQAEADREWVLAHYSRTAKKRSLLA 215 IRQGT+EQ+EA+REWVL+HY+RTAKKRSLL+ Sbjct: 258 IRQGTLEQSEAEREWVLSHYTRTAKKRSLLS 288 >ref|XP_006460009.1| hypothetical protein AGABI2DRAFT_67378, partial [Agaricus bisporus var. bisporus H97] gi|426198218|gb|EKV48144.1| hypothetical protein AGABI2DRAFT_67378, partial [Agaricus bisporus var. bisporus H97] Length = 308 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/32 (75%), Positives = 31/32 (96%) Frame = -1 Query: 307 IRQGTIEQAEADREWVLAHYSRTAKKRSLLAG 212 IRQGTIEQ EA+REWVL+HY+RTA+KR++L+G Sbjct: 258 IRQGTIEQVEAEREWVLSHYTRTARKRNVLSG 289 >ref|XP_003036670.1| hypothetical protein SCHCODRAFT_46039 [Schizophyllum commune H4-8] gi|300110367|gb|EFJ01768.1| hypothetical protein SCHCODRAFT_46039, partial [Schizophyllum commune H4-8] Length = 307 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/32 (75%), Positives = 31/32 (96%) Frame = -1 Query: 307 IRQGTIEQAEADREWVLAHYSRTAKKRSLLAG 212 IRQGTIEQ E++REWVLAHY+RT+KKR++L+G Sbjct: 258 IRQGTIEQTESEREWVLAHYARTSKKRNVLSG 289 >ref|XP_007268258.1| Brix-domain-containing protein [Fomitiporia mediterranea MF3/22] gi|393215490|gb|EJD00981.1| Brix-domain-containing protein [Fomitiporia mediterranea MF3/22] Length = 288 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -1 Query: 307 IRQGTIEQAEADREWVLAHYSRTAKKRSLL 218 IRQGTIEQ EADREWVLAHY+RTAKKR ++ Sbjct: 259 IRQGTIEQDEADREWVLAHYTRTAKKRRMM 288