BLASTX nr result
ID: Paeonia25_contig00039492
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00039492 (397 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007368796.1| hypothetical protein DICSQDRAFT_66948 [Dicho... 61 1e-07 gb|EIW65007.1| hypothetical protein TRAVEDRAFT_110431 [Trametes ... 56 5e-06 >ref|XP_007368796.1| hypothetical protein DICSQDRAFT_66948 [Dichomitus squalens LYAD-421 SS1] gi|395326021|gb|EJF58435.1| hypothetical protein DICSQDRAFT_66948 [Dichomitus squalens LYAD-421 SS1] Length = 605 Score = 61.2 bits (147), Expect = 1e-07 Identities = 32/68 (47%), Positives = 42/68 (61%), Gaps = 6/68 (8%) Frame = +3 Query: 3 CLRYLYRFAREGTLHADVAANAREECRKIKSVARMAAQ---FGAW*TYGVCSRSA---RT 164 CLRYLYR+ REGTLH + AANAR+EC+KIK++ +M Q +YG+ RS + Sbjct: 490 CLRYLYRYYREGTLHTERAANARDECKKIKNITKMVTQVMHVCLASSYGIAHRSGYHRKR 549 Query: 165 RTEFQDWL 188 R WL Sbjct: 550 RNPVGQWL 557 >gb|EIW65007.1| hypothetical protein TRAVEDRAFT_110431 [Trametes versicolor FP-101664 SS1] Length = 434 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/38 (63%), Positives = 32/38 (84%) Frame = +3 Query: 3 CLRYLYRFAREGTLHADVAANAREECRKIKSVARMAAQ 116 CLRYL+R+ REG L +D AANAREEC+KIK++A+ +Q Sbjct: 386 CLRYLHRYYREGALRSDRAANAREECKKIKNIAKTVSQ 423