BLASTX nr result
ID: Paeonia25_contig00039269
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00039269 (377 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001399936.2| plasma membrane proteolipid 3 [Aspergillus n... 86 7e-15 emb|CAK37766.1| unnamed protein product [Aspergillus niger] 86 7e-15 ref|XP_002621662.1| stress response RCI peptide [Ajellomyces der... 84 2e-14 ref|XP_001271232.1| stress response RCI peptide, putative [Asper... 84 2e-14 ref|XP_754386.1| stress response RCI peptide [Aspergillus fumiga... 83 3e-14 ref|XP_002372900.1| stress response RCI peptide, putative [Asper... 83 3e-14 ref|XP_002793522.1| plasma membrane proteolipid 3 [Paracoccidioi... 83 4e-14 gb|EYE94240.1| UPF0057-domain-containing protein [Aspergillus ru... 82 6e-14 ref|XP_002562011.1| Pc18g01670 [Penicillium chrysogenum Wisconsi... 82 6e-14 ref|XP_002152869.1| stress response RCI peptide, putative [Talar... 82 6e-14 ref|XP_001239989.1| conserved hypothetical protein [Coccidioides... 82 6e-14 ref|XP_002545056.1| conserved hypothetical protein [Uncinocarpus... 82 8e-14 ref|XP_002486625.1| stress response RCI peptide, putative [Talar... 82 1e-13 gb|EZF09764.1| plasma membrane proteolipid 3 [Trichophyton rubru... 81 2e-13 gb|EGE00702.1| hypothetical protein TESG_07996 [Trichophyton ton... 81 2e-13 ref|XP_003239369.1| plasma membrane proteolipid 3 [Trichophyton ... 81 2e-13 ref|XP_003176091.1| plasma membrane proteolipid 3 [Arthroderma g... 81 2e-13 ref|XP_001213332.1| conserved hypothetical protein [Aspergillus ... 81 2e-13 ref|XP_006458206.1| hypothetical protein AGABI2DRAFT_115218 [Aga... 80 2e-13 gb|EEH22014.1| plasma membrane proteolipid 3 [Paracoccidioides b... 80 2e-13 >ref|XP_001399936.2| plasma membrane proteolipid 3 [Aspergillus niger CBS 513.88] Length = 57 Score = 85.5 bits (210), Expect = 7e-15 Identities = 37/45 (82%), Positives = 42/45 (93%) Frame = -2 Query: 136 MAVTASDICKIIFAVLLPPVAVFLDRGCGADFLINICLTILGWIP 2 M TASDICKIIFA++LPP+ VFL+RGCGADFLINICLTILGW+P Sbjct: 1 MPFTASDICKIIFAIILPPLGVFLERGCGADFLINICLTILGWLP 45 >emb|CAK37766.1| unnamed protein product [Aspergillus niger] Length = 130 Score = 85.5 bits (210), Expect = 7e-15 Identities = 37/45 (82%), Positives = 42/45 (93%) Frame = -2 Query: 136 MAVTASDICKIIFAVLLPPVAVFLDRGCGADFLINICLTILGWIP 2 M TASDICKIIFA++LPP+ VFL+RGCGADFLINICLTILGW+P Sbjct: 1 MPFTASDICKIIFAIILPPLGVFLERGCGADFLINICLTILGWLP 45 >ref|XP_002621662.1| stress response RCI peptide [Ajellomyces dermatitidis SLH14081] gi|239591085|gb|EEQ73666.1| stress response RCI peptide [Ajellomyces dermatitidis SLH14081] gi|239614775|gb|EEQ91762.1| stress response RCI peptide [Ajellomyces dermatitidis ER-3] gi|327352206|gb|EGE81063.1| plasma membrane proteolipid 3 [Ajellomyces dermatitidis ATCC 18188] gi|531979654|gb|EQL30241.1| plasma membrane proteolipid 3 [Ajellomyces dermatitidis ATCC 26199] Length = 57 Score = 84.0 bits (206), Expect = 2e-14 Identities = 38/45 (84%), Positives = 42/45 (93%) Frame = -2 Query: 136 MAVTASDICKIIFAVLLPPVAVFLDRGCGADFLINICLTILGWIP 2 MA TASDICKIIFA+LLPPV VFL+RGCGAD LINICLT+LG+IP Sbjct: 1 MAFTASDICKIIFAILLPPVGVFLERGCGADLLINICLTVLGYIP 45 >ref|XP_001271232.1| stress response RCI peptide, putative [Aspergillus clavatus NRRL 1] gi|119399378|gb|EAW09806.1| stress response RCI peptide, putative [Aspergillus clavatus NRRL 1] Length = 57 Score = 84.0 bits (206), Expect = 2e-14 Identities = 37/45 (82%), Positives = 41/45 (91%) Frame = -2 Query: 136 MAVTASDICKIIFAVLLPPVAVFLDRGCGADFLINICLTILGWIP 2 M TASDICKIIFA++LPP+ VFL+RGCGAD LINICLTILGWIP Sbjct: 1 MPFTASDICKIIFAIILPPLGVFLERGCGADLLINICLTILGWIP 45 >ref|XP_754386.1| stress response RCI peptide [Aspergillus fumigatus Af293] gi|119491277|ref|XP_001263227.1| stress response RCI peptide, putative [Neosartorya fischeri NRRL 181] gi|74674487|sp|Q4WYA5.1|PMP3_ASPFU RecName: Full=Plasma membrane proteolipid 3 gi|66852023|gb|EAL92348.1| stress response RCI peptide, putative [Aspergillus fumigatus Af293] gi|119411387|gb|EAW21330.1| stress response RCI peptide, putative [Neosartorya fischeri NRRL 181] gi|159127400|gb|EDP52515.1| stress response RCI peptide, putative [Aspergillus fumigatus A1163] Length = 57 Score = 83.2 bits (204), Expect = 3e-14 Identities = 36/45 (80%), Positives = 41/45 (91%) Frame = -2 Query: 136 MAVTASDICKIIFAVLLPPVAVFLDRGCGADFLINICLTILGWIP 2 M TASDICKI+FA++LPP+ VFL+RGCGAD LINICLTILGWIP Sbjct: 1 MPFTASDICKILFAIILPPLGVFLERGCGADLLINICLTILGWIP 45 >ref|XP_002372900.1| stress response RCI peptide, putative [Aspergillus flavus NRRL3357] gi|317139792|ref|XP_003189201.1| plasma membrane proteolipid 3 [Aspergillus oryzae RIB40] gi|220700950|gb|EED57288.1| stress response RCI peptide, putative [Aspergillus flavus NRRL3357] Length = 57 Score = 83.2 bits (204), Expect = 3e-14 Identities = 36/45 (80%), Positives = 41/45 (91%) Frame = -2 Query: 136 MAVTASDICKIIFAVLLPPVAVFLDRGCGADFLINICLTILGWIP 2 M TASDICKI+FA++LPP+ VFL+RGCGAD LINICLTILGWIP Sbjct: 1 MPFTASDICKILFAIILPPLGVFLERGCGADLLINICLTILGWIP 45 >ref|XP_002793522.1| plasma membrane proteolipid 3 [Paracoccidioides sp. 'lutzii' Pb01] gi|226277816|gb|EEH33382.1| plasma membrane proteolipid 3 [Paracoccidioides sp. 'lutzii' Pb01] Length = 74 Score = 82.8 bits (203), Expect = 4e-14 Identities = 37/45 (82%), Positives = 42/45 (93%) Frame = -2 Query: 136 MAVTASDICKIIFAVLLPPVAVFLDRGCGADFLINICLTILGWIP 2 MA TASD+CKIIFAVLLPP+ VFL+RGCGAD LIN+CLTILG+IP Sbjct: 1 MAFTASDVCKIIFAVLLPPLGVFLERGCGADLLINVCLTILGYIP 45 >gb|EYE94240.1| UPF0057-domain-containing protein [Aspergillus ruber CBS 135680] Length = 57 Score = 82.4 bits (202), Expect = 6e-14 Identities = 37/45 (82%), Positives = 40/45 (88%) Frame = -2 Query: 136 MAVTASDICKIIFAVLLPPVAVFLDRGCGADFLINICLTILGWIP 2 M TASDICKII A +LPP+ VFL+RGCGADFLINICLTILGWIP Sbjct: 1 MPFTASDICKIILAFILPPLGVFLERGCGADFLINICLTILGWIP 45 >ref|XP_002562011.1| Pc18g01670 [Penicillium chrysogenum Wisconsin 54-1255] gi|211586744|emb|CAP94391.1| Pc18g01670 [Penicillium chrysogenum Wisconsin 54-1255] gi|584409824|emb|CDM33848.1| Plasma membrane proteolipid 3 [Penicillium roqueforti] Length = 57 Score = 82.4 bits (202), Expect = 6e-14 Identities = 37/45 (82%), Positives = 41/45 (91%) Frame = -2 Query: 136 MAVTASDICKIIFAVLLPPVAVFLDRGCGADFLINICLTILGWIP 2 M TASDICKIIFA++LPP+ VFL+RGCGADFLINI LTILGWIP Sbjct: 1 MPFTASDICKIIFAIILPPLGVFLERGCGADFLINILLTILGWIP 45 >ref|XP_002152869.1| stress response RCI peptide, putative [Talaromyces marneffei ATCC 18224] gi|210065838|gb|EEA19932.1| stress response RCI peptide, putative [Talaromyces marneffei ATCC 18224] Length = 57 Score = 82.4 bits (202), Expect = 6e-14 Identities = 37/45 (82%), Positives = 42/45 (93%) Frame = -2 Query: 136 MAVTASDICKIIFAVLLPPVAVFLDRGCGADFLINICLTILGWIP 2 M +TASDICKIIFA++LPPV VFL+RGCGAD LINICLTILG+IP Sbjct: 1 MPLTASDICKIIFAIILPPVGVFLERGCGADLLINICLTILGYIP 45 >ref|XP_001239989.1| conserved hypothetical protein [Coccidioides immitis RS] gi|303318427|ref|XP_003069213.1| hypothetical protein CPC735_024040 [Coccidioides posadasii C735 delta SOWgp] gi|240108899|gb|EER27068.1| hypothetical protein CPC735_024040 [Coccidioides posadasii C735 delta SOWgp] gi|320039099|gb|EFW21034.1| hypothetical protein CPSG_02877 [Coccidioides posadasii str. Silveira] gi|392864744|gb|EAS27354.2| plasma membrane proteolipid 3 [Coccidioides immitis RS] Length = 57 Score = 82.4 bits (202), Expect = 6e-14 Identities = 37/45 (82%), Positives = 42/45 (93%) Frame = -2 Query: 136 MAVTASDICKIIFAVLLPPVAVFLDRGCGADFLINICLTILGWIP 2 MA TASDICKIIFA++LPP+ VFL+RGCGAD LINICLTILG+IP Sbjct: 1 MAFTASDICKIIFAIILPPLGVFLERGCGADLLINICLTILGYIP 45 >ref|XP_002545056.1| conserved hypothetical protein [Uncinocarpus reesii 1704] gi|237905326|gb|EEP79727.1| conserved hypothetical protein [Uncinocarpus reesii 1704] Length = 59 Score = 82.0 bits (201), Expect = 8e-14 Identities = 37/45 (82%), Positives = 42/45 (93%) Frame = -2 Query: 136 MAVTASDICKIIFAVLLPPVAVFLDRGCGADFLINICLTILGWIP 2 MA TASDICKIIFA++LPP+ VFL+RGCGAD LINICLTILG+IP Sbjct: 1 MAFTASDICKIIFAIVLPPLGVFLERGCGADLLINICLTILGYIP 45 >ref|XP_002486625.1| stress response RCI peptide, putative [Talaromyces stipitatus ATCC 10500] gi|218714964|gb|EED14387.1| stress response RCI peptide, putative [Talaromyces stipitatus ATCC 10500] Length = 57 Score = 81.6 bits (200), Expect = 1e-13 Identities = 37/45 (82%), Positives = 41/45 (91%) Frame = -2 Query: 136 MAVTASDICKIIFAVLLPPVAVFLDRGCGADFLINICLTILGWIP 2 M TASDICKIIFA++LPPV VFL+RGCGAD LINICLTILG+IP Sbjct: 1 MPFTASDICKIIFAIILPPVGVFLERGCGADLLINICLTILGYIP 45 >gb|EZF09764.1| plasma membrane proteolipid 3 [Trichophyton rubrum MR850] gi|607898802|gb|EZF36625.1| plasma membrane proteolipid 3 [Trichophyton rubrum CBS 100081] gi|607911073|gb|EZF47388.1| plasma membrane proteolipid 3 [Trichophyton rubrum CBS 288.86] gi|607947019|gb|EZF79277.1| plasma membrane proteolipid 3 [Trichophyton rubrum MR1448] gi|607959483|gb|EZF90250.1| plasma membrane proteolipid 3 [Trichophyton rubrum MR1459] gi|607983109|gb|EZG11474.1| plasma membrane proteolipid 3 [Trichophyton rubrum CBS 202.88] Length = 76 Score = 80.9 bits (198), Expect = 2e-13 Identities = 36/45 (80%), Positives = 41/45 (91%) Frame = -2 Query: 136 MAVTASDICKIIFAVLLPPVAVFLDRGCGADFLINICLTILGWIP 2 MA TASDICKII A++LPP+ VFL+RGCGAD LINICLTILG+IP Sbjct: 1 MAFTASDICKIILAIILPPIGVFLERGCGADLLINICLTILGYIP 45 >gb|EGE00702.1| hypothetical protein TESG_07996 [Trichophyton tonsurans CBS 112818] Length = 50 Score = 80.9 bits (198), Expect = 2e-13 Identities = 36/45 (80%), Positives = 41/45 (91%) Frame = -2 Query: 136 MAVTASDICKIIFAVLLPPVAVFLDRGCGADFLINICLTILGWIP 2 MA TASDICKII A++LPP+ VFL+RGCGAD LINICLTILG+IP Sbjct: 1 MAFTASDICKIILAIILPPIGVFLERGCGADLLINICLTILGYIP 45 >ref|XP_003239369.1| plasma membrane proteolipid 3 [Trichophyton rubrum CBS 118892] gi|326459625|gb|EGD85078.1| plasma membrane proteolipid 3 [Trichophyton rubrum CBS 118892] gi|607891044|gb|EZF30853.1| plasma membrane proteolipid 3 [Trichophyton interdigitale H6] gi|607923076|gb|EZF57955.1| plasma membrane proteolipid 3 [Trichophyton rubrum CBS 289.86] gi|607935032|gb|EZF68603.1| plasma membrane proteolipid 3 [Trichophyton soudanense CBS 452.61] gi|607947021|gb|EZF79279.1| plasma membrane proteolipid 3 [Trichophyton rubrum MR1448] gi|607983111|gb|EZG11476.1| plasma membrane proteolipid 3 [Trichophyton rubrum CBS 202.88] Length = 57 Score = 80.9 bits (198), Expect = 2e-13 Identities = 36/45 (80%), Positives = 41/45 (91%) Frame = -2 Query: 136 MAVTASDICKIIFAVLLPPVAVFLDRGCGADFLINICLTILGWIP 2 MA TASDICKII A++LPP+ VFL+RGCGAD LINICLTILG+IP Sbjct: 1 MAFTASDICKIILAIILPPIGVFLERGCGADLLINICLTILGYIP 45 >ref|XP_003176091.1| plasma membrane proteolipid 3 [Arthroderma gypseum CBS 118893] gi|311337937|gb|EFQ97139.1| plasma membrane proteolipid 3 [Arthroderma gypseum CBS 118893] Length = 68 Score = 80.9 bits (198), Expect = 2e-13 Identities = 36/45 (80%), Positives = 41/45 (91%) Frame = -2 Query: 136 MAVTASDICKIIFAVLLPPVAVFLDRGCGADFLINICLTILGWIP 2 MA TASDICKII A++LPP+ VFL+RGCGAD LINICLTILG+IP Sbjct: 1 MAFTASDICKIILAIILPPIGVFLERGCGADLLINICLTILGYIP 45 >ref|XP_001213332.1| conserved hypothetical protein [Aspergillus terreus NIH2624] gi|114194256|gb|EAU35956.1| conserved hypothetical protein [Aspergillus terreus NIH2624] Length = 57 Score = 80.9 bits (198), Expect = 2e-13 Identities = 36/45 (80%), Positives = 39/45 (86%) Frame = -2 Query: 136 MAVTASDICKIIFAVLLPPVAVFLDRGCGADFLINICLTILGWIP 2 M TASDICKI FA +LPP+ VFL+RGCGAD LINICLTILGWIP Sbjct: 1 MPFTASDICKIFFAFILPPLGVFLERGCGADLLINICLTILGWIP 45 >ref|XP_006458206.1| hypothetical protein AGABI2DRAFT_115218 [Agaricus bisporus var. bisporus H97] gi|597968289|ref|XP_007326688.1| hypothetical protein AGABI1DRAFT_125228 [Agaricus bisporus var. burnettii JB137-S8] gi|409082403|gb|EKM82761.1| hypothetical protein AGABI1DRAFT_125228 [Agaricus bisporus var. burnettii JB137-S8] gi|426200236|gb|EKV50160.1| hypothetical protein AGABI2DRAFT_115218 [Agaricus bisporus var. bisporus H97] Length = 57 Score = 80.5 bits (197), Expect = 2e-13 Identities = 36/45 (80%), Positives = 40/45 (88%) Frame = -2 Query: 136 MAVTASDICKIIFAVLLPPVAVFLDRGCGADFLINICLTILGWIP 2 MA TASDICKIIFA++ PP+ VFL+RGCGAD LINI LTILGWIP Sbjct: 1 MAFTASDICKIIFAIIFPPLGVFLERGCGADLLINILLTILGWIP 45 >gb|EEH22014.1| plasma membrane proteolipid 3 [Paracoccidioides brasiliensis Pb03] gi|226293095|gb|EEH48515.1| plasma membrane proteolipid 3 [Paracoccidioides brasiliensis Pb18] Length = 57 Score = 80.5 bits (197), Expect = 2e-13 Identities = 34/45 (75%), Positives = 41/45 (91%) Frame = -2 Query: 136 MAVTASDICKIIFAVLLPPVAVFLDRGCGADFLINICLTILGWIP 2 MA TASD+CKI+FA+ LPP+ VFL+RGCGAD LIN+CLTILG+IP Sbjct: 1 MAFTASDVCKIVFAIFLPPLGVFLERGCGADLLINVCLTILGYIP 45