BLASTX nr result
ID: Paeonia25_contig00039120
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00039120 (257 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007045472.1| Anthranilate synthase beta subunit 1 [Theobr... 90 3e-16 ref|XP_002878947.1| predicted protein [Arabidopsis lyrata subsp.... 90 4e-16 ref|XP_002876803.1| hypothetical protein ARALYDRAFT_484144 [Arab... 89 6e-16 ref|XP_002527548.1| Anthranilate synthase component II, putative... 89 8e-16 ref|XP_002312481.2| hypothetical protein POPTR_0008s13820g [Popu... 87 2e-15 ref|XP_004297400.1| PREDICTED: anthranilate synthase component I... 87 2e-15 ref|XP_003547656.1| PREDICTED: anthranilate synthase component 2... 87 2e-15 ref|XP_007222508.1| hypothetical protein PRUPE_ppa009800mg [Prun... 87 3e-15 ref|XP_002314761.1| anthranilate synthase beta subunit 1 family ... 87 3e-15 ref|XP_007153189.1| hypothetical protein PHAVU_003G014300g [Phas... 86 4e-15 ref|NP_200597.1| glutamine amidotransferase type 1 family protei... 86 7e-15 ref|XP_006469298.1| PREDICTED: anthranilate synthase component 2... 86 7e-15 ref|XP_006448093.1| hypothetical protein CICLE_v100161761mg, par... 86 7e-15 ref|XP_006304070.1| hypothetical protein CARUB_v10009928mg [Caps... 86 7e-15 ref|XP_002890696.1| hypothetical protein ARALYDRAFT_472860 [Arab... 86 7e-15 gb|ACJ84848.1| unknown [Medicago truncatula] gi|388498572|gb|AFK... 86 7e-15 gb|AAM65944.1| anthranilate synthase beta chain [Arabidopsis tha... 86 7e-15 ref|NP_173893.1| anthranilate synthase beta subunit 1 [Arabidops... 85 1e-14 ref|XP_003529236.1| PREDICTED: anthranilate synthase component 2... 85 1e-14 ref|NP_001185092.1| anthranilate synthase beta subunit 1 [Arabid... 85 1e-14 >ref|XP_007045472.1| Anthranilate synthase beta subunit 1 [Theobroma cacao] gi|508709407|gb|EOY01304.1| Anthranilate synthase beta subunit 1 [Theobroma cacao] Length = 280 Score = 90.1 bits (222), Expect = 3e-16 Identities = 45/52 (86%), Positives = 47/52 (90%) Frame = -3 Query: 255 TEDGLIRASRHKKYKHLQGVQFHPESIITSEGKHIVGNFVKLIEKKEADESK 100 TEDGLI A+RHK YKHLQGVQFHPESIITSEGK IV NFVKLIEKKEA ES+ Sbjct: 228 TEDGLIMAARHKVYKHLQGVQFHPESIITSEGKTIVRNFVKLIEKKEAAESQ 279 >ref|XP_002878947.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297324786|gb|EFH55206.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 275 Score = 89.7 bits (221), Expect = 4e-16 Identities = 39/50 (78%), Positives = 48/50 (96%) Frame = -3 Query: 255 TEDGLIRASRHKKYKHLQGVQFHPESIITSEGKHIVGNFVKLIEKKEADE 106 TEDGL+ A+RHKKYKH+QGVQFHPESIIT+EGK IVGNF+KL+EKKE+++ Sbjct: 224 TEDGLVMAARHKKYKHIQGVQFHPESIITTEGKTIVGNFIKLVEKKESEK 273 >ref|XP_002876803.1| hypothetical protein ARALYDRAFT_484144 [Arabidopsis lyrata subsp. lyrata] gi|297322641|gb|EFH53062.1| hypothetical protein ARALYDRAFT_484144 [Arabidopsis lyrata subsp. lyrata] Length = 276 Score = 89.0 bits (219), Expect = 6e-16 Identities = 39/50 (78%), Positives = 48/50 (96%) Frame = -3 Query: 255 TEDGLIRASRHKKYKHLQGVQFHPESIITSEGKHIVGNFVKLIEKKEADE 106 TEDGL+ A+RH+KYKH+QGVQFHPESIIT+EGK IVGNF+KLIEKKE+++ Sbjct: 225 TEDGLVMAARHRKYKHIQGVQFHPESIITTEGKTIVGNFIKLIEKKESEK 274 >ref|XP_002527548.1| Anthranilate synthase component II, putative [Ricinus communis] gi|223533098|gb|EEF34857.1| Anthranilate synthase component II, putative [Ricinus communis] Length = 281 Score = 88.6 bits (218), Expect = 8e-16 Identities = 41/49 (83%), Positives = 46/49 (93%) Frame = -3 Query: 255 TEDGLIRASRHKKYKHLQGVQFHPESIITSEGKHIVGNFVKLIEKKEAD 109 TEDGLI A+RHKKYKHLQGVQFHPESIITSEGK IV NF+KL+E+KEA+ Sbjct: 230 TEDGLIMAARHKKYKHLQGVQFHPESIITSEGKTIVQNFIKLVERKEAE 278 >ref|XP_002312481.2| hypothetical protein POPTR_0008s13820g [Populus trichocarpa] gi|550333014|gb|EEE89848.2| hypothetical protein POPTR_0008s13820g [Populus trichocarpa] Length = 278 Score = 87.4 bits (215), Expect = 2e-15 Identities = 40/49 (81%), Positives = 46/49 (93%) Frame = -3 Query: 255 TEDGLIRASRHKKYKHLQGVQFHPESIITSEGKHIVGNFVKLIEKKEAD 109 TEDGLI A+RH+KYKHLQGVQFHPESIITSEGK IV NF+K+IE+KEA+ Sbjct: 227 TEDGLIMAARHRKYKHLQGVQFHPESIITSEGKIIVSNFIKMIERKEAE 275 >ref|XP_004297400.1| PREDICTED: anthranilate synthase component II-like [Fragaria vesca subsp. vesca] Length = 277 Score = 87.0 bits (214), Expect = 2e-15 Identities = 41/49 (83%), Positives = 46/49 (93%) Frame = -3 Query: 255 TEDGLIRASRHKKYKHLQGVQFHPESIITSEGKHIVGNFVKLIEKKEAD 109 TEDGLI A+RHKKYK+LQGVQFHPESIITSEG+ IVGNFVKLIEK E++ Sbjct: 226 TEDGLIMAARHKKYKYLQGVQFHPESIITSEGRTIVGNFVKLIEKSESE 274 >ref|XP_003547656.1| PREDICTED: anthranilate synthase component 2-like isoform 1 [Glycine max] Length = 278 Score = 87.0 bits (214), Expect = 2e-15 Identities = 43/51 (84%), Positives = 45/51 (88%) Frame = -3 Query: 255 TEDGLIRASRHKKYKHLQGVQFHPESIITSEGKHIVGNFVKLIEKKEADES 103 TEDGLI A+RHKKYKHLQGVQFHPESIIT EGK IV NFVKLIEK+EA S Sbjct: 228 TEDGLIMAARHKKYKHLQGVQFHPESIITPEGKTIVRNFVKLIEKREAGGS 278 >ref|XP_007222508.1| hypothetical protein PRUPE_ppa009800mg [Prunus persica] gi|462419444|gb|EMJ23707.1| hypothetical protein PRUPE_ppa009800mg [Prunus persica] Length = 277 Score = 86.7 bits (213), Expect = 3e-15 Identities = 40/49 (81%), Positives = 46/49 (93%) Frame = -3 Query: 255 TEDGLIRASRHKKYKHLQGVQFHPESIITSEGKHIVGNFVKLIEKKEAD 109 TEDGLI A+RHKKY+HLQGVQFHPESIITSEGK IV NF+KLIEK+E++ Sbjct: 226 TEDGLIMAARHKKYRHLQGVQFHPESIITSEGKTIVRNFIKLIEKRESE 274 >ref|XP_002314761.1| anthranilate synthase beta subunit 1 family protein [Populus trichocarpa] gi|222863801|gb|EEF00932.1| anthranilate synthase beta subunit 1 family protein [Populus trichocarpa] Length = 276 Score = 86.7 bits (213), Expect = 3e-15 Identities = 39/49 (79%), Positives = 46/49 (93%) Frame = -3 Query: 255 TEDGLIRASRHKKYKHLQGVQFHPESIITSEGKHIVGNFVKLIEKKEAD 109 TEDGLI A+RH+KYKHLQGVQFHPESIITSEGK IV NF+K++E+KEA+ Sbjct: 225 TEDGLIMAARHRKYKHLQGVQFHPESIITSEGKTIVRNFIKMVERKEAE 273 >ref|XP_007153189.1| hypothetical protein PHAVU_003G014300g [Phaseolus vulgaris] gi|561026543|gb|ESW25183.1| hypothetical protein PHAVU_003G014300g [Phaseolus vulgaris] Length = 277 Score = 86.3 bits (212), Expect = 4e-15 Identities = 43/51 (84%), Positives = 44/51 (86%) Frame = -3 Query: 255 TEDGLIRASRHKKYKHLQGVQFHPESIITSEGKHIVGNFVKLIEKKEADES 103 TEDGLI A+RHKKYKHLQGVQFHPESIIT EGK IV NFVKLIEK EA S Sbjct: 227 TEDGLIMAARHKKYKHLQGVQFHPESIITPEGKKIVQNFVKLIEKMEAGGS 277 >ref|NP_200597.1| glutamine amidotransferase type 1 family protein [Arabidopsis thaliana] gi|75171068|sp|Q9FJM5.1|ASB2_ARATH RecName: Full=Anthranilate synthase beta subunit 2, chloroplastic; AltName: Full=Anthranilate synthase component 2-2; AltName: Full=Anthranilate synthase, glutamine amidotransferase component 2-2; Flags: Precursor gi|9758358|dbj|BAB08859.1| anthranilate synthase beta chain [Arabidopsis thaliana] gi|90186236|gb|ABD91494.1| At5g57890 [Arabidopsis thaliana] gi|332009585|gb|AED96968.1| glutamine amidotransferase type 1 family protein [Arabidopsis thaliana] Length = 273 Score = 85.5 bits (210), Expect = 7e-15 Identities = 37/50 (74%), Positives = 47/50 (94%) Frame = -3 Query: 255 TEDGLIRASRHKKYKHLQGVQFHPESIITSEGKHIVGNFVKLIEKKEADE 106 TEDGL+ A+RH+KYKH+QGVQFHPESIIT+EGK IV NF+KL+EKKE+++ Sbjct: 222 TEDGLVMAARHRKYKHIQGVQFHPESIITTEGKTIVRNFIKLVEKKESEK 271 >ref|XP_006469298.1| PREDICTED: anthranilate synthase component 2-like [Citrus sinensis] Length = 283 Score = 85.5 bits (210), Expect = 7e-15 Identities = 40/52 (76%), Positives = 47/52 (90%) Frame = -3 Query: 255 TEDGLIRASRHKKYKHLQGVQFHPESIITSEGKHIVGNFVKLIEKKEADESK 100 TEDGLI A+RHKKYKHLQGVQFHPESIIT+EGK IV NF+K+I +KEA +S+ Sbjct: 231 TEDGLIMAARHKKYKHLQGVQFHPESIITTEGKTIVRNFIKMIVRKEAADSQ 282 >ref|XP_006448093.1| hypothetical protein CICLE_v100161761mg, partial [Citrus clementina] gi|557550704|gb|ESR61333.1| hypothetical protein CICLE_v100161761mg, partial [Citrus clementina] Length = 80 Score = 85.5 bits (210), Expect = 7e-15 Identities = 40/52 (76%), Positives = 47/52 (90%) Frame = -3 Query: 255 TEDGLIRASRHKKYKHLQGVQFHPESIITSEGKHIVGNFVKLIEKKEADESK 100 TEDGLI A+RHKKYKHLQGVQFHPESIIT+EGK IV NF+K+I +KEA +S+ Sbjct: 28 TEDGLIMAARHKKYKHLQGVQFHPESIITTEGKTIVRNFIKMIVRKEAADSQ 79 >ref|XP_006304070.1| hypothetical protein CARUB_v10009928mg [Capsella rubella] gi|482572781|gb|EOA36968.1| hypothetical protein CARUB_v10009928mg [Capsella rubella] Length = 286 Score = 85.5 bits (210), Expect = 7e-15 Identities = 37/50 (74%), Positives = 47/50 (94%) Frame = -3 Query: 255 TEDGLIRASRHKKYKHLQGVQFHPESIITSEGKHIVGNFVKLIEKKEADE 106 TEDGL+ A+RH+KYKH+QGVQFHPESIIT+EGK IV NF+KL+EKKE+++ Sbjct: 235 TEDGLVMAARHRKYKHIQGVQFHPESIITTEGKTIVRNFIKLVEKKESEK 284 >ref|XP_002890696.1| hypothetical protein ARALYDRAFT_472860 [Arabidopsis lyrata subsp. lyrata] gi|297336538|gb|EFH66955.1| hypothetical protein ARALYDRAFT_472860 [Arabidopsis lyrata subsp. lyrata] Length = 277 Score = 85.5 bits (210), Expect = 7e-15 Identities = 37/50 (74%), Positives = 47/50 (94%) Frame = -3 Query: 255 TEDGLIRASRHKKYKHLQGVQFHPESIITSEGKHIVGNFVKLIEKKEADE 106 TEDGL+ A+RH+KYKH+QGVQFHPESIIT+EGK IV NF+KL+EKKE+++ Sbjct: 226 TEDGLVMAARHRKYKHIQGVQFHPESIITTEGKTIVRNFIKLVEKKESEK 275 >gb|ACJ84848.1| unknown [Medicago truncatula] gi|388498572|gb|AFK37352.1| unknown [Medicago truncatula] Length = 270 Score = 85.5 bits (210), Expect = 7e-15 Identities = 41/51 (80%), Positives = 45/51 (88%) Frame = -3 Query: 255 TEDGLIRASRHKKYKHLQGVQFHPESIITSEGKHIVGNFVKLIEKKEADES 103 TEDGLI A+RHKKY+H+QGVQFHPESIIT +GK IV NFVKLIEKKEA S Sbjct: 220 TEDGLIMAARHKKYRHMQGVQFHPESIITPDGKTIVHNFVKLIEKKEAARS 270 >gb|AAM65944.1| anthranilate synthase beta chain [Arabidopsis thaliana] Length = 273 Score = 85.5 bits (210), Expect = 7e-15 Identities = 37/50 (74%), Positives = 47/50 (94%) Frame = -3 Query: 255 TEDGLIRASRHKKYKHLQGVQFHPESIITSEGKHIVGNFVKLIEKKEADE 106 TEDGL+ A+RH+KYKH+QGVQFHPESIIT+EGK IV NF+KL+EKKE+++ Sbjct: 222 TEDGLVMAARHRKYKHIQGVQFHPESIITTEGKTIVRNFIKLVEKKESEK 271 >ref|NP_173893.1| anthranilate synthase beta subunit 1 [Arabidopsis thaliana] gi|75102739|sp|Q42565.1|ASB1_ARATH RecName: Full=Anthranilate synthase beta subunit 1, chloroplastic; AltName: Full=Anthranilate synthase component 2-1; AltName: Full=Anthranilate synthase, glutamine amidotransferase component 2-1; AltName: Full=Protein TRYPTOPHAN BIOSYNTHESIS 4; AltName: Full=Protein WEAK ETHYLENE INSENSITIVE 7; Flags: Precursor gi|11067285|gb|AAG28813.1|AC079374_16 anthranilate synthase beta subunit [Arabidopsis thaliana] gi|403434|gb|AAA32742.1| anthranilate synthase beta subunit [Arabidopsis thaliana] gi|20466736|gb|AAM20685.1| anthranilate synthase beta subunit [Arabidopsis thaliana] gi|30023756|gb|AAP13411.1| At1g25220 [Arabidopsis thaliana] gi|110741096|dbj|BAE98642.1| hypothetical protein [Arabidopsis thaliana] gi|332192468|gb|AEE30589.1| anthranilate synthase beta subunit 1 [Arabidopsis thaliana] Length = 276 Score = 84.7 bits (208), Expect = 1e-14 Identities = 36/50 (72%), Positives = 47/50 (94%) Frame = -3 Query: 255 TEDGLIRASRHKKYKHLQGVQFHPESIITSEGKHIVGNFVKLIEKKEADE 106 TEDGL+ A+RH+KYKH+QGVQFHPESIIT+EGK IV NF+K++EKKE+++ Sbjct: 225 TEDGLVMAARHRKYKHIQGVQFHPESIITTEGKTIVRNFIKIVEKKESEK 274 >ref|XP_003529236.1| PREDICTED: anthranilate synthase component 2-like [Glycine max] Length = 276 Score = 84.7 bits (208), Expect = 1e-14 Identities = 41/48 (85%), Positives = 43/48 (89%) Frame = -3 Query: 255 TEDGLIRASRHKKYKHLQGVQFHPESIITSEGKHIVGNFVKLIEKKEA 112 TEDGLI A+RHKKYKHLQGVQFHPESIIT EGK IV NFVKLIE+ EA Sbjct: 226 TEDGLIMAARHKKYKHLQGVQFHPESIITPEGKTIVHNFVKLIERSEA 273 >ref|NP_001185092.1| anthranilate synthase beta subunit 1 [Arabidopsis thaliana] gi|332192469|gb|AEE30590.1| anthranilate synthase beta subunit 1 [Arabidopsis thaliana] Length = 289 Score = 84.7 bits (208), Expect = 1e-14 Identities = 36/50 (72%), Positives = 47/50 (94%) Frame = -3 Query: 255 TEDGLIRASRHKKYKHLQGVQFHPESIITSEGKHIVGNFVKLIEKKEADE 106 TEDGL+ A+RH+KYKH+QGVQFHPESIIT+EGK IV NF+K++EKKE+++ Sbjct: 238 TEDGLVMAARHRKYKHIQGVQFHPESIITTEGKTIVRNFIKIVEKKESEK 287