BLASTX nr result
ID: Paeonia25_contig00039034
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00039034 (300 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004149399.1| PREDICTED: exosome complex component RRP43-l... 67 3e-09 emb|CBI29839.3| unnamed protein product [Vitis vinifera] 65 8e-09 ref|XP_002284088.1| PREDICTED: exosome complex component RRP43-l... 65 8e-09 emb|CAN82224.1| hypothetical protein VITISV_011872 [Vitis vinifera] 65 8e-09 ref|XP_006602939.1| PREDICTED: exosome complex component RRP43 i... 65 1e-08 ref|XP_004498461.1| PREDICTED: exosome complex component RRP43-l... 65 1e-08 ref|XP_007202373.1| hypothetical protein PRUPE_ppa009278mg [Prun... 65 1e-08 ref|XP_003531860.1| PREDICTED: exosome complex component RRP43-l... 65 1e-08 ref|NP_001276207.1| uncharacterized protein LOC100812139 [Glycin... 65 1e-08 ref|XP_006373782.1| hypothetical protein POPTR_0016s05590g [Popu... 64 2e-08 ref|XP_002322717.1| 3' exoribonuclease domain 1-containing famil... 64 2e-08 ref|XP_006489986.1| PREDICTED: exosome complex component RRP43-l... 64 2e-08 ref|XP_006421389.1| hypothetical protein CICLE_v10005512mg [Citr... 64 2e-08 ref|XP_004304353.1| PREDICTED: exosome complex component RRP43-l... 64 2e-08 ref|XP_004304352.1| PREDICTED: exosome complex component RRP43-l... 64 2e-08 ref|XP_002532079.1| exosome complex exonuclease rrp43, putative ... 64 2e-08 ref|XP_006596183.1| PREDICTED: exosome complex component RRP43-l... 64 3e-08 ref|XP_003544676.1| PREDICTED: exosome complex component RRP43-l... 64 3e-08 ref|XP_007028731.1| 3'-5'-exoribonuclease family protein [Theobr... 63 4e-08 ref|XP_003588422.1| Exosome complex exonuclease RRP43 [Medicago ... 63 4e-08 >ref|XP_004149399.1| PREDICTED: exosome complex component RRP43-like [Cucumis sativus] gi|449503802|ref|XP_004162184.1| PREDICTED: exosome complex component RRP43-like [Cucumis sativus] Length = 304 Score = 67.0 bits (162), Expect = 3e-09 Identities = 35/43 (81%), Positives = 38/43 (88%), Gaps = 1/43 (2%) Frame = -1 Query: 300 KNYILADLT-QEESIMETTVTMVLDLSGQLVSFYKPGGSVLAY 175 K YILAD T +EES+MET VT+VLD SGQLVSFYKPGGSVLAY Sbjct: 230 KKYILADPTAEEESVMETIVTVVLDSSGQLVSFYKPGGSVLAY 272 >emb|CBI29839.3| unnamed protein product [Vitis vinifera] Length = 311 Score = 65.5 bits (158), Expect = 8e-09 Identities = 35/43 (81%), Positives = 37/43 (86%), Gaps = 1/43 (2%) Frame = -1 Query: 300 KNYILADLT-QEESIMETTVTMVLDLSGQLVSFYKPGGSVLAY 175 KNYILAD T +EESIMET VT+VLD SGQLVS YKPGG VLAY Sbjct: 237 KNYILADPTAEEESIMETLVTVVLDSSGQLVSLYKPGGPVLAY 279 >ref|XP_002284088.1| PREDICTED: exosome complex component RRP43-like [Vitis vinifera] Length = 303 Score = 65.5 bits (158), Expect = 8e-09 Identities = 35/43 (81%), Positives = 37/43 (86%), Gaps = 1/43 (2%) Frame = -1 Query: 300 KNYILADLT-QEESIMETTVTMVLDLSGQLVSFYKPGGSVLAY 175 KNYILAD T +EESIMET VT+VLD SGQLVS YKPGG VLAY Sbjct: 229 KNYILADPTAEEESIMETLVTVVLDSSGQLVSLYKPGGPVLAY 271 >emb|CAN82224.1| hypothetical protein VITISV_011872 [Vitis vinifera] Length = 1621 Score = 65.5 bits (158), Expect = 8e-09 Identities = 35/43 (81%), Positives = 37/43 (86%), Gaps = 1/43 (2%) Frame = -1 Query: 300 KNYILADLT-QEESIMETTVTMVLDLSGQLVSFYKPGGSVLAY 175 KNYILAD T +EESIMET VT+VLD SGQLVS YKPGG VLAY Sbjct: 230 KNYILADPTAEEESIMETLVTVVLDSSGQLVSLYKPGGPVLAY 272 >ref|XP_006602939.1| PREDICTED: exosome complex component RRP43 isoform X1 [Glycine max] gi|571549405|ref|XP_006602940.1| PREDICTED: exosome complex component RRP43 isoform X2 [Glycine max] Length = 203 Score = 65.1 bits (157), Expect = 1e-08 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 1/43 (2%) Frame = -1 Query: 300 KNYILADLT-QEESIMETTVTMVLDLSGQLVSFYKPGGSVLAY 175 KNYILAD T +EESIMET VT+VLD SGQL+S YKPGG VLAY Sbjct: 130 KNYILADPTAEEESIMETHVTVVLDTSGQLISLYKPGGPVLAY 172 >ref|XP_004498461.1| PREDICTED: exosome complex component RRP43-like [Cicer arietinum] Length = 302 Score = 65.1 bits (157), Expect = 1e-08 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 1/43 (2%) Frame = -1 Query: 300 KNYILADLT-QEESIMETTVTMVLDLSGQLVSFYKPGGSVLAY 175 KNYILAD T +EESIMET VT+VLD SGQL+S YKPGG VLAY Sbjct: 228 KNYILADPTAEEESIMETHVTIVLDTSGQLISLYKPGGPVLAY 270 >ref|XP_007202373.1| hypothetical protein PRUPE_ppa009278mg [Prunus persica] gi|462397904|gb|EMJ03572.1| hypothetical protein PRUPE_ppa009278mg [Prunus persica] Length = 299 Score = 65.1 bits (157), Expect = 1e-08 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 1/43 (2%) Frame = -1 Query: 300 KNYILADLT-QEESIMETTVTMVLDLSGQLVSFYKPGGSVLAY 175 KNYILAD T +EES+MET VT+VLD SGQLVS YKPGG VLAY Sbjct: 225 KNYILADPTAEEESVMETLVTVVLDSSGQLVSLYKPGGPVLAY 267 >ref|XP_003531860.1| PREDICTED: exosome complex component RRP43-like [Glycine max] Length = 302 Score = 65.1 bits (157), Expect = 1e-08 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 1/43 (2%) Frame = -1 Query: 300 KNYILADLT-QEESIMETTVTMVLDLSGQLVSFYKPGGSVLAY 175 KNYILAD T +EESIMET VT+VLD SGQL+S YKPGG VLAY Sbjct: 228 KNYILADPTAEEESIMETHVTVVLDTSGQLISLYKPGGPVLAY 270 >ref|NP_001276207.1| uncharacterized protein LOC100812139 [Glycine max] gi|255644374|gb|ACU22692.1| unknown [Glycine max] Length = 170 Score = 65.1 bits (157), Expect = 1e-08 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 1/43 (2%) Frame = -1 Query: 300 KNYILADLT-QEESIMETTVTMVLDLSGQLVSFYKPGGSVLAY 175 KNYILAD T +EESIMET VT+VLD SGQL+S YKPGG VLAY Sbjct: 97 KNYILADPTAEEESIMETHVTVVLDTSGQLISLYKPGGPVLAY 139 >ref|XP_006373782.1| hypothetical protein POPTR_0016s05590g [Populus trichocarpa] gi|550320907|gb|ERP51579.1| hypothetical protein POPTR_0016s05590g [Populus trichocarpa] Length = 323 Score = 64.3 bits (155), Expect = 2e-08 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 1/43 (2%) Frame = -1 Query: 300 KNYILADLT-QEESIMETTVTMVLDLSGQLVSFYKPGGSVLAY 175 KNYILAD T +EESIMET VT+VLD S +LVSFYKPGGSV AY Sbjct: 249 KNYILADPTAEEESIMETLVTVVLDSSARLVSFYKPGGSVFAY 291 >ref|XP_002322717.1| 3' exoribonuclease domain 1-containing family protein [Populus trichocarpa] gi|222867347|gb|EEF04478.1| 3' exoribonuclease domain 1-containing family protein [Populus trichocarpa] Length = 439 Score = 64.3 bits (155), Expect = 2e-08 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 1/43 (2%) Frame = -1 Query: 300 KNYILADLT-QEESIMETTVTMVLDLSGQLVSFYKPGGSVLAY 175 KNYILAD T +EESIMET VT+VLD S +LVSFYKPGGSV AY Sbjct: 249 KNYILADPTAEEESIMETLVTVVLDSSARLVSFYKPGGSVFAY 291 >ref|XP_006489986.1| PREDICTED: exosome complex component RRP43-like isoform X1 [Citrus sinensis] gi|568873742|ref|XP_006489987.1| PREDICTED: exosome complex component RRP43-like isoform X2 [Citrus sinensis] Length = 302 Score = 63.9 bits (154), Expect = 2e-08 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 1/43 (2%) Frame = -1 Query: 300 KNYILADLT-QEESIMETTVTMVLDLSGQLVSFYKPGGSVLAY 175 KNYILAD T +EESIMET VT+VLD S QLVS YKPGG+VLAY Sbjct: 228 KNYILADPTSEEESIMETLVTVVLDSSNQLVSLYKPGGAVLAY 270 >ref|XP_006421389.1| hypothetical protein CICLE_v10005512mg [Citrus clementina] gi|567857414|ref|XP_006421390.1| hypothetical protein CICLE_v10005512mg [Citrus clementina] gi|557523262|gb|ESR34629.1| hypothetical protein CICLE_v10005512mg [Citrus clementina] gi|557523263|gb|ESR34630.1| hypothetical protein CICLE_v10005512mg [Citrus clementina] Length = 302 Score = 63.9 bits (154), Expect = 2e-08 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 1/43 (2%) Frame = -1 Query: 300 KNYILADLT-QEESIMETTVTMVLDLSGQLVSFYKPGGSVLAY 175 KNYILAD T +EESIMET VT+VLD S QLVS YKPGG+VLAY Sbjct: 228 KNYILADPTSEEESIMETLVTVVLDSSNQLVSLYKPGGAVLAY 270 >ref|XP_004304353.1| PREDICTED: exosome complex component RRP43-like isoform 2 [Fragaria vesca subsp. vesca] Length = 300 Score = 63.9 bits (154), Expect = 2e-08 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 1/43 (2%) Frame = -1 Query: 300 KNYILADLT-QEESIMETTVTMVLDLSGQLVSFYKPGGSVLAY 175 KN+ILAD T +EESIMET VT+VLD SGQLVS YKPGG VLAY Sbjct: 226 KNFILADPTAEEESIMETLVTVVLDSSGQLVSLYKPGGPVLAY 268 >ref|XP_004304352.1| PREDICTED: exosome complex component RRP43-like isoform 1 [Fragaria vesca subsp. vesca] Length = 328 Score = 63.9 bits (154), Expect = 2e-08 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 1/43 (2%) Frame = -1 Query: 300 KNYILADLT-QEESIMETTVTMVLDLSGQLVSFYKPGGSVLAY 175 KN+ILAD T +EESIMET VT+VLD SGQLVS YKPGG VLAY Sbjct: 226 KNFILADPTAEEESIMETLVTVVLDSSGQLVSLYKPGGPVLAY 268 >ref|XP_002532079.1| exosome complex exonuclease rrp43, putative [Ricinus communis] gi|223528261|gb|EEF30313.1| exosome complex exonuclease rrp43, putative [Ricinus communis] Length = 303 Score = 63.9 bits (154), Expect = 2e-08 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 1/43 (2%) Frame = -1 Query: 300 KNYILADLT-QEESIMETTVTMVLDLSGQLVSFYKPGGSVLAY 175 KNYILAD T +EESIMET VT+VLD S +LVSFYKPGG VLAY Sbjct: 229 KNYILADPTAEEESIMETLVTVVLDSSARLVSFYKPGGPVLAY 271 >ref|XP_006596183.1| PREDICTED: exosome complex component RRP43-like isoform X2 [Glycine max] gi|571509870|ref|XP_006596184.1| PREDICTED: exosome complex component RRP43-like isoform X3 [Glycine max] Length = 307 Score = 63.5 bits (153), Expect = 3e-08 Identities = 33/43 (76%), Positives = 36/43 (83%), Gaps = 1/43 (2%) Frame = -1 Query: 300 KNYILADLT-QEESIMETTVTMVLDLSGQLVSFYKPGGSVLAY 175 KNYILAD T +EESIMET VT+VLD SGQL+S YKPGG LAY Sbjct: 232 KNYILADPTAEEESIMETHVTIVLDTSGQLISLYKPGGPALAY 274 >ref|XP_003544676.1| PREDICTED: exosome complex component RRP43-like isoform X1 [Glycine max] gi|571509874|ref|XP_006596185.1| PREDICTED: exosome complex component RRP43-like isoform X4 [Glycine max] Length = 299 Score = 63.5 bits (153), Expect = 3e-08 Identities = 33/43 (76%), Positives = 36/43 (83%), Gaps = 1/43 (2%) Frame = -1 Query: 300 KNYILADLT-QEESIMETTVTMVLDLSGQLVSFYKPGGSVLAY 175 KNYILAD T +EESIMET VT+VLD SGQL+S YKPGG LAY Sbjct: 224 KNYILADPTAEEESIMETHVTIVLDTSGQLISLYKPGGPALAY 266 >ref|XP_007028731.1| 3'-5'-exoribonuclease family protein [Theobroma cacao] gi|508717336|gb|EOY09233.1| 3'-5'-exoribonuclease family protein [Theobroma cacao] Length = 302 Score = 63.2 bits (152), Expect = 4e-08 Identities = 34/43 (79%), Positives = 36/43 (83%), Gaps = 1/43 (2%) Frame = -1 Query: 300 KNYILADLT-QEESIMETTVTMVLDLSGQLVSFYKPGGSVLAY 175 KNYILAD T +EESIMET VT+VLD S QLVS YKPGG VLAY Sbjct: 228 KNYILADPTAEEESIMETLVTIVLDSSSQLVSLYKPGGPVLAY 270 >ref|XP_003588422.1| Exosome complex exonuclease RRP43 [Medicago truncatula] gi|355477470|gb|AES58673.1| Exosome complex exonuclease RRP43 [Medicago truncatula] Length = 133 Score = 63.2 bits (152), Expect = 4e-08 Identities = 32/43 (74%), Positives = 37/43 (86%), Gaps = 1/43 (2%) Frame = -1 Query: 300 KNYILADLT-QEESIMETTVTMVLDLSGQLVSFYKPGGSVLAY 175 KNYILAD T +EESI+ET VT++LD SGQL+S YKPGG VLAY Sbjct: 59 KNYILADPTAEEESIVETHVTIILDTSGQLISLYKPGGPVLAY 101