BLASTX nr result
ID: Paeonia25_contig00039006
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00039006 (319 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002303363.2| acyl-CoA oxidase family protein [Populus tri... 60 2e-07 ref|XP_003608684.1| Peroxisomal acyl-CoA oxidase 1A [Medicago tr... 58 1e-06 ref|XP_004508938.1| PREDICTED: peroxisomal acyl-coenzyme A oxida... 58 2e-06 ref|XP_003517411.2| PREDICTED: peroxisomal acyl-coenzyme A oxida... 57 2e-06 ref|XP_006368995.1| acyl-CoA oxidase family protein [Populus tri... 57 2e-06 ref|XP_006837312.1| hypothetical protein AMTR_s00111p00062720 [A... 57 2e-06 ref|XP_006440266.1| hypothetical protein CICLE_v10019196mg [Citr... 57 3e-06 ref|XP_006440265.1| hypothetical protein CICLE_v10019196mg [Citr... 57 3e-06 ref|XP_006440264.1| hypothetical protein CICLE_v10019196mg [Citr... 57 3e-06 ref|XP_007155689.1| hypothetical protein PHAVU_003G222800g [Phas... 57 3e-06 ref|XP_007210302.1| hypothetical protein PRUPE_ppa002510mg [Prun... 57 3e-06 ref|XP_002525341.1| acyl-CoA oxidase, putative [Ricinus communis... 57 3e-06 gb|EYU19298.1| hypothetical protein MIMGU_mgv1a002541mg [Mimulus... 56 4e-06 ref|XP_006355420.1| PREDICTED: peroxisomal acyl-coenzyme A oxida... 56 4e-06 ref|XP_007157269.1| hypothetical protein PHAVU_002G056700g [Phas... 56 4e-06 gb|AAW78691.1| peroxisomal acyl-CoA oxidase 1A [Solanum cheesman... 56 4e-06 ref|NP_001234198.1| peroxisomal acyl-CoA oxidase 1A [Solanum lyc... 56 4e-06 pdb|2FON|A Chain A, X-Ray Crystal Structure Of Leacx1, An Acyl-C... 56 4e-06 gb|EPS60529.1| hypothetical protein M569_14274, partial [Genlise... 56 6e-06 ref|XP_003611339.1| Peroxisomal acyl-CoA oxidase 1A [Medicago tr... 56 6e-06 >ref|XP_002303363.2| acyl-CoA oxidase family protein [Populus trichocarpa] gi|550342653|gb|EEE78342.2| acyl-CoA oxidase family protein [Populus trichocarpa] Length = 663 Score = 60.5 bits (145), Expect = 2e-07 Identities = 30/42 (71%), Positives = 32/42 (76%), Gaps = 1/42 (2%) Frame = +1 Query: 1 GFIFQL*-LDDHPPLSGITVSDTGMKFRNGVYNTKENGVLTF 123 GFI QL LDDH PL GIT+ D GMKF NG YNT +NGVLTF Sbjct: 203 GFIVQLRSLDDHMPLPGITIGDIGMKFGNGAYNTMDNGVLTF 244 >ref|XP_003608684.1| Peroxisomal acyl-CoA oxidase 1A [Medicago truncatula] gi|355509739|gb|AES90881.1| Peroxisomal acyl-CoA oxidase 1A [Medicago truncatula] Length = 664 Score = 58.2 bits (139), Expect = 1e-06 Identities = 30/42 (71%), Positives = 31/42 (73%), Gaps = 1/42 (2%) Frame = +1 Query: 1 GFIFQL*-LDDHPPLSGITVSDTGMKFRNGVYNTKENGVLTF 123 GFI QL LDDH PL GITV D GMKF NG YNT +NGVL F Sbjct: 203 GFIVQLRSLDDHLPLPGITVGDIGMKFGNGAYNTMDNGVLRF 244 >ref|XP_004508938.1| PREDICTED: peroxisomal acyl-coenzyme A oxidase 1-like [Cicer arietinum] Length = 664 Score = 57.8 bits (138), Expect = 2e-06 Identities = 29/42 (69%), Positives = 31/42 (73%), Gaps = 1/42 (2%) Frame = +1 Query: 1 GFIFQL*-LDDHPPLSGITVSDTGMKFRNGVYNTKENGVLTF 123 GFI QL LDDH PL GIT+ D GMKF NG YNT +NGVL F Sbjct: 203 GFIVQLRSLDDHLPLPGITIGDIGMKFGNGAYNTMDNGVLRF 244 >ref|XP_003517411.2| PREDICTED: peroxisomal acyl-coenzyme A oxidase 1-like [Glycine max] Length = 729 Score = 57.4 bits (137), Expect = 2e-06 Identities = 29/42 (69%), Positives = 31/42 (73%), Gaps = 1/42 (2%) Frame = +1 Query: 1 GFIFQL*-LDDHPPLSGITVSDTGMKFRNGVYNTKENGVLTF 123 GFI QL LDDH PLSGIT+ D GMKF N YNT +NGVL F Sbjct: 268 GFIVQLRSLDDHLPLSGITIGDIGMKFGNAAYNTMDNGVLRF 309 >ref|XP_006368995.1| acyl-CoA oxidase family protein [Populus trichocarpa] gi|550347354|gb|ERP65564.1| acyl-CoA oxidase family protein [Populus trichocarpa] Length = 664 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/42 (66%), Positives = 31/42 (73%), Gaps = 1/42 (2%) Frame = +1 Query: 1 GFIFQL*-LDDHPPLSGITVSDTGMKFRNGVYNTKENGVLTF 123 GFI QL LDDH PL G+T+ D GMKF NG YNT +NGVL F Sbjct: 203 GFIVQLRSLDDHMPLPGLTIGDIGMKFGNGAYNTMDNGVLKF 244 >ref|XP_006837312.1| hypothetical protein AMTR_s00111p00062720 [Amborella trichopoda] gi|548839930|gb|ERN00166.1| hypothetical protein AMTR_s00111p00062720 [Amborella trichopoda] Length = 664 Score = 57.4 bits (137), Expect = 2e-06 Identities = 29/42 (69%), Positives = 31/42 (73%), Gaps = 1/42 (2%) Frame = +1 Query: 1 GFIFQL*-LDDHPPLSGITVSDTGMKFRNGVYNTKENGVLTF 123 GFI QL L+DH PL GITV D GMKF NG YNT +NGVL F Sbjct: 203 GFIVQLRSLEDHSPLPGITVGDIGMKFGNGAYNTMDNGVLRF 244 >ref|XP_006440266.1| hypothetical protein CICLE_v10019196mg [Citrus clementina] gi|567895558|ref|XP_006440267.1| hypothetical protein CICLE_v10019196mg [Citrus clementina] gi|557542528|gb|ESR53506.1| hypothetical protein CICLE_v10019196mg [Citrus clementina] gi|557542529|gb|ESR53507.1| hypothetical protein CICLE_v10019196mg [Citrus clementina] Length = 529 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/42 (66%), Positives = 31/42 (73%), Gaps = 1/42 (2%) Frame = +1 Query: 1 GFIFQL*-LDDHPPLSGITVSDTGMKFRNGVYNTKENGVLTF 123 GFI QL L+DH PL GIT+ D GMKF NG YNT +NGVL F Sbjct: 203 GFIVQLRSLEDHSPLPGITIGDIGMKFGNGAYNTMDNGVLRF 244 >ref|XP_006440265.1| hypothetical protein CICLE_v10019196mg [Citrus clementina] gi|557542527|gb|ESR53505.1| hypothetical protein CICLE_v10019196mg [Citrus clementina] Length = 601 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/42 (66%), Positives = 31/42 (73%), Gaps = 1/42 (2%) Frame = +1 Query: 1 GFIFQL*-LDDHPPLSGITVSDTGMKFRNGVYNTKENGVLTF 123 GFI QL L+DH PL GIT+ D GMKF NG YNT +NGVL F Sbjct: 203 GFIVQLRSLEDHSPLPGITIGDIGMKFGNGAYNTMDNGVLRF 244 >ref|XP_006440264.1| hypothetical protein CICLE_v10019196mg [Citrus clementina] gi|557542526|gb|ESR53504.1| hypothetical protein CICLE_v10019196mg [Citrus clementina] Length = 664 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/42 (66%), Positives = 31/42 (73%), Gaps = 1/42 (2%) Frame = +1 Query: 1 GFIFQL*-LDDHPPLSGITVSDTGMKFRNGVYNTKENGVLTF 123 GFI QL L+DH PL GIT+ D GMKF NG YNT +NGVL F Sbjct: 203 GFIVQLRSLEDHSPLPGITIGDIGMKFGNGAYNTMDNGVLRF 244 >ref|XP_007155689.1| hypothetical protein PHAVU_003G222800g [Phaseolus vulgaris] gi|561029043|gb|ESW27683.1| hypothetical protein PHAVU_003G222800g [Phaseolus vulgaris] Length = 493 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/42 (69%), Positives = 31/42 (73%), Gaps = 1/42 (2%) Frame = +1 Query: 1 GFIFQL*-LDDHPPLSGITVSDTGMKFRNGVYNTKENGVLTF 123 GFI QL LDDH PL GITV D GMKF NG YN+ +NGVL F Sbjct: 204 GFIVQLRSLDDHLPLPGITVGDIGMKFGNGAYNSMDNGVLRF 245 >ref|XP_007210302.1| hypothetical protein PRUPE_ppa002510mg [Prunus persica] gi|402744131|gb|AFQ93693.1| acyl-CoA oxidase 1 [Prunus persica] gi|462406037|gb|EMJ11501.1| hypothetical protein PRUPE_ppa002510mg [Prunus persica] Length = 664 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/42 (69%), Positives = 31/42 (73%), Gaps = 1/42 (2%) Frame = +1 Query: 1 GFIFQL*-LDDHPPLSGITVSDTGMKFRNGVYNTKENGVLTF 123 GFI QL LDDH PL GITV D GMKF NG YN+ +NGVL F Sbjct: 203 GFIVQLRNLDDHLPLPGITVGDIGMKFGNGAYNSMDNGVLRF 244 >ref|XP_002525341.1| acyl-CoA oxidase, putative [Ricinus communis] gi|223535400|gb|EEF37074.1| acyl-CoA oxidase, putative [Ricinus communis] Length = 664 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/42 (69%), Positives = 31/42 (73%), Gaps = 1/42 (2%) Frame = +1 Query: 1 GFIFQL*-LDDHPPLSGITVSDTGMKFRNGVYNTKENGVLTF 123 GFI QL LDDH PL GITV D GMKF +G YNT +NGVL F Sbjct: 203 GFIVQLRSLDDHMPLPGITVGDIGMKFGSGAYNTMDNGVLRF 244 >gb|EYU19298.1| hypothetical protein MIMGU_mgv1a002541mg [Mimulus guttatus] Length = 661 Score = 56.2 bits (134), Expect = 4e-06 Identities = 29/42 (69%), Positives = 31/42 (73%), Gaps = 1/42 (2%) Frame = +1 Query: 1 GFIFQL*-LDDHPPLSGITVSDTGMKFRNGVYNTKENGVLTF 123 GFI QL L+DH PL GITV D GMKF NG YNT +NGVL F Sbjct: 200 GFIVQLRSLEDHTPLPGITVGDIGMKFGNGGYNTMDNGVLRF 241 >ref|XP_006355420.1| PREDICTED: peroxisomal acyl-coenzyme A oxidase 1-like [Solanum tuberosum] Length = 664 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/42 (64%), Positives = 32/42 (76%), Gaps = 1/42 (2%) Frame = +1 Query: 1 GFIFQL*-LDDHPPLSGITVSDTGMKFRNGVYNTKENGVLTF 123 GFI QL L+DH PL G+TV D GMKF NG YN+ +NGVL+F Sbjct: 203 GFIVQLRSLEDHKPLPGVTVGDIGMKFGNGAYNSMDNGVLSF 244 >ref|XP_007157269.1| hypothetical protein PHAVU_002G056700g [Phaseolus vulgaris] gi|561030684|gb|ESW29263.1| hypothetical protein PHAVU_002G056700g [Phaseolus vulgaris] Length = 664 Score = 56.2 bits (134), Expect = 4e-06 Identities = 29/42 (69%), Positives = 31/42 (73%), Gaps = 1/42 (2%) Frame = +1 Query: 1 GFIFQL*-LDDHPPLSGITVSDTGMKFRNGVYNTKENGVLTF 123 GFI QL LD+H PL GITV D GMKF N YNT +NGVLTF Sbjct: 203 GFIVQLRSLDNHLPLPGITVGDIGMKFGNAAYNTMDNGVLTF 244 >gb|AAW78691.1| peroxisomal acyl-CoA oxidase 1A [Solanum cheesmaniae] Length = 664 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/42 (64%), Positives = 32/42 (76%), Gaps = 1/42 (2%) Frame = +1 Query: 1 GFIFQL*-LDDHPPLSGITVSDTGMKFRNGVYNTKENGVLTF 123 GFI QL L+DH PL G+TV D GMKF NG YN+ +NGVL+F Sbjct: 203 GFIVQLRSLEDHKPLPGVTVGDIGMKFGNGAYNSMDNGVLSF 244 >ref|NP_001234198.1| peroxisomal acyl-CoA oxidase 1A [Solanum lycopersicum] gi|58531948|gb|AAW78689.1| peroxisomal acyl-CoA oxidase 1A [Solanum lycopersicum] Length = 664 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/42 (64%), Positives = 32/42 (76%), Gaps = 1/42 (2%) Frame = +1 Query: 1 GFIFQL*-LDDHPPLSGITVSDTGMKFRNGVYNTKENGVLTF 123 GFI QL L+DH PL G+TV D GMKF NG YN+ +NGVL+F Sbjct: 203 GFIVQLRSLEDHKPLPGVTVGDIGMKFGNGAYNSMDNGVLSF 244 >pdb|2FON|A Chain A, X-Ray Crystal Structure Of Leacx1, An Acyl-Coa Oxidase From Lycopersicon Esculentum (Tomato) gi|109157677|pdb|2FON|B Chain B, X-Ray Crystal Structure Of Leacx1, An Acyl-Coa Oxidase From Lycopersicon Esculentum (Tomato) gi|109157678|pdb|2FON|C Chain C, X-Ray Crystal Structure Of Leacx1, An Acyl-Coa Oxidase From Lycopersicon Esculentum (Tomato) Length = 683 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/42 (64%), Positives = 32/42 (76%), Gaps = 1/42 (2%) Frame = +1 Query: 1 GFIFQL*-LDDHPPLSGITVSDTGMKFRNGVYNTKENGVLTF 123 GFI QL L+DH PL G+TV D GMKF NG YN+ +NGVL+F Sbjct: 222 GFIVQLRSLEDHKPLPGVTVGDIGMKFGNGAYNSMDNGVLSF 263 >gb|EPS60529.1| hypothetical protein M569_14274, partial [Genlisea aurea] Length = 387 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/42 (66%), Positives = 31/42 (73%), Gaps = 1/42 (2%) Frame = +1 Query: 1 GFIFQL*-LDDHPPLSGITVSDTGMKFRNGVYNTKENGVLTF 123 GFI QL L+DH PL GITV D G+KF NG YNT +NGVL F Sbjct: 156 GFIVQLRSLEDHTPLPGITVGDIGVKFGNGAYNTMDNGVLRF 197 >ref|XP_003611339.1| Peroxisomal acyl-CoA oxidase 1A [Medicago truncatula] gi|355512674|gb|AES94297.1| Peroxisomal acyl-CoA oxidase 1A [Medicago truncatula] Length = 664 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/42 (69%), Positives = 30/42 (71%), Gaps = 1/42 (2%) Frame = +1 Query: 1 GFIFQL*-LDDHPPLSGITVSDTGMKFRNGVYNTKENGVLTF 123 GFI QL LDDH PL GITV D GMKF N YNT +NGVL F Sbjct: 203 GFIVQLRSLDDHLPLPGITVGDIGMKFGNAAYNTMDNGVLRF 244