BLASTX nr result
ID: Paeonia25_contig00038359
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00038359 (453 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007396452.1| hypothetical protein PHACADRAFT_209644 [Phan... 62 8e-08 >ref|XP_007396452.1| hypothetical protein PHACADRAFT_209644 [Phanerochaete carnosa HHB-10118-sp] gi|409046677|gb|EKM56157.1| hypothetical protein PHACADRAFT_209644 [Phanerochaete carnosa HHB-10118-sp] Length = 609 Score = 62.0 bits (149), Expect = 8e-08 Identities = 38/94 (40%), Positives = 49/94 (52%), Gaps = 2/94 (2%) Frame = +3 Query: 174 EHKPEDDWTQPDR--HTRLYPEICGLIGEGGFGRVYLAKLPEMHDEPVALKVFHKATLFR 347 + P DWT P H + G++GEGG GRV A+ H VA+KV HKA +R Sbjct: 218 DEDPLGDWTGPPMLTHADQAYVVLGMLGEGGSGRVMCARARTGHT--VAIKVVHKARAYR 275 Query: 348 LQYARCRLKDELRLLKYVTQKRLPFACHLLQSWE 449 + R LKDE + VT +R PF LL SW+ Sbjct: 276 DPFGRENLKDEKFTWERVTHERRPFLVSLLLSWD 309