BLASTX nr result
ID: Paeonia25_contig00038291
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00038291 (315 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006289141.1| hypothetical protein CARUB_v10002564mg [Caps... 59 5e-07 ref|XP_006369032.1| HyPRP family protein [Populus trichocarpa] g... 59 7e-07 ref|XP_006477231.1| PREDICTED: 14 kDa proline-rich protein DC2.1... 59 9e-07 ref|XP_006440346.1| hypothetical protein CICLE_v10022839mg [Citr... 59 9e-07 ref|XP_002304421.2| hypothetical protein POPTR_0003s11070g, part... 59 9e-07 ref|XP_007039887.1| Bifunctional inhibitor/lipid-transfer protei... 59 9e-07 ref|XP_006368194.1| HyPRP family protein [Populus trichocarpa] g... 59 9e-07 gb|ABQ88334.1| lipid transfer protein [Capsicum annuum] 59 9e-07 emb|CAI51313.1| arachidonic acid-induced DEA1 [Capsicum chinense] 59 9e-07 dbj|BAA11854.1| extensin like protein [Populus nigra] gi|1199774... 59 9e-07 dbj|BAB16431.1| P-rich protein NtEIG-C29 [Nicotiana tabacum] 58 1e-06 dbj|BAF46299.1| extensin like protein [Ipomoea nil] 58 2e-06 gb|EYU30303.1| hypothetical protein MIMGU_mgv1a016181mg [Mimulus... 57 2e-06 ref|XP_006477234.1| PREDICTED: 14 kDa proline-rich protein DC2.1... 57 2e-06 ref|XP_006440349.1| hypothetical protein CICLE_v10022832mg [Citr... 57 2e-06 ref|XP_004291443.1| PREDICTED: 14 kDa proline-rich protein DC2.1... 57 2e-06 ref|XP_004291442.1| PREDICTED: 14 kDa proline-rich protein DC2.1... 57 2e-06 ref|XP_004291441.1| PREDICTED: 14 kDa proline-rich protein DC2.1... 57 2e-06 ref|XP_007209745.1| hypothetical protein PRUPE_ppa013010mg [Prun... 57 2e-06 gb|AAL26908.1|AF318173_1 extensin-like protein, partial [Prunus ... 57 2e-06 >ref|XP_006289141.1| hypothetical protein CARUB_v10002564mg [Capsella rubella] gi|482557847|gb|EOA22039.1| hypothetical protein CARUB_v10002564mg [Capsella rubella] Length = 135 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -3 Query: 313 ANILGINLNVPISLSLLLNTCGKEVPSDFKC 221 AN+LGINLNVP+SLSLLLN CGK+VPS FKC Sbjct: 104 ANVLGINLNVPVSLSLLLNVCGKKVPSGFKC 134 >ref|XP_006369032.1| HyPRP family protein [Populus trichocarpa] gi|550347391|gb|ERP65601.1| HyPRP family protein [Populus trichocarpa] Length = 132 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -3 Query: 313 ANILGINLNVPISLSLLLNTCGKEVPSDFKC 221 ANILGINLN+P+SLSLLLN CGK+VP DF+C Sbjct: 101 ANILGINLNIPVSLSLLLNVCGKKVPKDFQC 131 >ref|XP_006477231.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Citrus sinensis] Length = 130 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = -3 Query: 313 ANILGINLNVPISLSLLLNTCGKEVPSDFKC 221 ANILGIN+N+PISLSLL+NTCGK++PSDF C Sbjct: 99 ANILGININIPISLSLLINTCGKKLPSDFIC 129 >ref|XP_006440346.1| hypothetical protein CICLE_v10022839mg [Citrus clementina] gi|557542608|gb|ESR53586.1| hypothetical protein CICLE_v10022839mg [Citrus clementina] Length = 130 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = -3 Query: 313 ANILGINLNVPISLSLLLNTCGKEVPSDFKC 221 ANILGIN+N+PISLSLL+NTCGK++PSDF C Sbjct: 99 ANILGININIPISLSLLINTCGKKLPSDFIC 129 >ref|XP_002304421.2| hypothetical protein POPTR_0003s11070g, partial [Populus trichocarpa] gi|550342945|gb|EEE79400.2| hypothetical protein POPTR_0003s11070g, partial [Populus trichocarpa] Length = 120 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -3 Query: 313 ANILGINLNVPISLSLLLNTCGKEVPSDFKC 221 ANILGINLN+P+SLSLLLN CGK+VP DF+C Sbjct: 89 ANILGINLNIPLSLSLLLNVCGKKVPKDFQC 119 >ref|XP_007039887.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein [Theobroma cacao] gi|508777132|gb|EOY24388.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein [Theobroma cacao] Length = 132 Score = 58.5 bits (140), Expect = 9e-07 Identities = 24/31 (77%), Positives = 30/31 (96%) Frame = -3 Query: 313 ANILGINLNVPISLSLLLNTCGKEVPSDFKC 221 AN+LGIN+N+PISLSLL+NTCGK++PSDF C Sbjct: 101 ANVLGININIPISLSLLINTCGKQLPSDFIC 131 >ref|XP_006368194.1| HyPRP family protein [Populus trichocarpa] gi|118481415|gb|ABK92650.1| unknown [Populus trichocarpa] gi|550346093|gb|ERP64763.1| HyPRP family protein [Populus trichocarpa] Length = 140 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -3 Query: 313 ANILGINLNVPISLSLLLNTCGKEVPSDFKC 221 ANILGINLN+PISLSLL+N CGK+VP DF+C Sbjct: 109 ANILGINLNIPISLSLLINVCGKKVPKDFQC 139 >gb|ABQ88334.1| lipid transfer protein [Capsicum annuum] Length = 142 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -3 Query: 313 ANILGINLNVPISLSLLLNTCGKEVPSDFKC 221 ANILGINLNVPISLSLLLN CGK+VPS F+C Sbjct: 110 ANILGINLNVPISLSLLLNVCGKKVPSGFQC 140 >emb|CAI51313.1| arachidonic acid-induced DEA1 [Capsicum chinense] Length = 142 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -3 Query: 313 ANILGINLNVPISLSLLLNTCGKEVPSDFKC 221 ANILGINLNVPISLSLLLN CGK+VPS F+C Sbjct: 110 ANILGINLNVPISLSLLLNVCGKKVPSGFQC 140 >dbj|BAA11854.1| extensin like protein [Populus nigra] gi|1199774|dbj|BAA11855.1| extensin like protein [Populus nigra] Length = 141 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -3 Query: 313 ANILGINLNVPISLSLLLNTCGKEVPSDFKC 221 ANILGINLN+P+SLSLLLN CGK+VP DF+C Sbjct: 110 ANILGINLNIPLSLSLLLNVCGKKVPKDFQC 140 >dbj|BAB16431.1| P-rich protein NtEIG-C29 [Nicotiana tabacum] Length = 130 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -3 Query: 313 ANILGINLNVPISLSLLLNTCGKEVPSDFKC 221 ANILGINLNVP+SLSLLLN CGK+VPS F+C Sbjct: 99 ANILGINLNVPLSLSLLLNVCGKQVPSGFQC 129 >dbj|BAF46299.1| extensin like protein [Ipomoea nil] Length = 133 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -3 Query: 313 ANILGINLNVPISLSLLLNTCGKEVPSDFKC 221 ANILGINLNVP+SLSLLLN CGK+VPS F+C Sbjct: 102 ANILGINLNVPLSLSLLLNVCGKKVPSGFQC 132 >gb|EYU30303.1| hypothetical protein MIMGU_mgv1a016181mg [Mimulus guttatus] Length = 131 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = -3 Query: 313 ANILGINLNVPISLSLLLNTCGKEVPSDFKC 221 ANILGIN+++PISLSLL+NTCGK +P DFKC Sbjct: 100 ANILGINIDIPISLSLLINTCGKTLPEDFKC 130 >ref|XP_006477234.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Citrus sinensis] Length = 134 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -3 Query: 313 ANILGINLNVPISLSLLLNTCGKEVPSDFKC 221 ANILGINLNVP+SLSLLLN CGK+VPS F+C Sbjct: 103 ANILGINLNVPVSLSLLLNFCGKKVPSGFQC 133 >ref|XP_006440349.1| hypothetical protein CICLE_v10022832mg [Citrus clementina] gi|557542611|gb|ESR53589.1| hypothetical protein CICLE_v10022832mg [Citrus clementina] Length = 131 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -3 Query: 313 ANILGINLNVPISLSLLLNTCGKEVPSDFKC 221 ANILGINLNVP+SLSLLLN CGK+VPS F+C Sbjct: 100 ANILGINLNVPVSLSLLLNFCGKKVPSGFQC 130 >ref|XP_004291443.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like isoform 3 [Fragaria vesca subsp. vesca] Length = 118 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -3 Query: 313 ANILGINLNVPISLSLLLNTCGKEVPSDFKCE 218 ANILGINLNVPISLSLLL+ C KEVP +FKCE Sbjct: 87 ANILGINLNVPISLSLLLSACQKEVPPNFKCE 118 >ref|XP_004291442.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like isoform 2 [Fragaria vesca subsp. vesca] Length = 129 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -3 Query: 313 ANILGINLNVPISLSLLLNTCGKEVPSDFKCE 218 ANILGINLNVPISLSLLL+ C KEVP +FKCE Sbjct: 98 ANILGINLNVPISLSLLLSACQKEVPPNFKCE 129 >ref|XP_004291441.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like isoform 1 [Fragaria vesca subsp. vesca] Length = 157 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -3 Query: 313 ANILGINLNVPISLSLLLNTCGKEVPSDFKCE 218 ANILGINLNVPISLSLLL+ C KEVP +FKCE Sbjct: 126 ANILGINLNVPISLSLLLSACQKEVPPNFKCE 157 >ref|XP_007209745.1| hypothetical protein PRUPE_ppa013010mg [Prunus persica] gi|462405480|gb|EMJ10944.1| hypothetical protein PRUPE_ppa013010mg [Prunus persica] Length = 144 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 313 ANILGINLNVPISLSLLLNTCGKEVPSDFKC 221 ANILGINLN+PISLSLLLN CG +VP DF+C Sbjct: 113 ANILGINLNIPISLSLLLNVCGNKVPKDFQC 143 >gb|AAL26908.1|AF318173_1 extensin-like protein, partial [Prunus persica] Length = 51 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 313 ANILGINLNVPISLSLLLNTCGKEVPSDFKC 221 ANILGINLN+PISLSLLLN CG +VP DF+C Sbjct: 20 ANILGINLNIPISLSLLLNVCGNKVPKDFQC 50