BLASTX nr result
ID: Paeonia25_contig00037760
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00037760 (230 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521544.1| conserved hypothetical protein [Ricinus comm... 59 5e-07 >ref|XP_002521544.1| conserved hypothetical protein [Ricinus communis] gi|223539222|gb|EEF40815.1| conserved hypothetical protein [Ricinus communis] Length = 275 Score = 59.3 bits (142), Expect = 5e-07 Identities = 32/62 (51%), Positives = 43/62 (69%), Gaps = 1/62 (1%) Frame = -1 Query: 230 EVCDEEPVAESE-LDDEMSNEEFQRVVEAFIAKQSKFHRQEFVSVALQKQS*IVFLEKNV 54 E C E ++E L+DE+S+EEFQR V+ FIAK + RQE +S+ LQK+S I +EKN Sbjct: 213 EKCRNEVISEGLCLEDELSDEEFQRAVDEFIAKHLRLRRQESMSIVLQKRSSISEIEKNG 272 Query: 53 KN 48 KN Sbjct: 273 KN 274