BLASTX nr result
ID: Paeonia25_contig00037607
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00037607 (309 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPT02753.1| hypothetical protein FOMPIDRAFT_142009 [Fomitopsi... 56 6e-06 >gb|EPT02753.1| hypothetical protein FOMPIDRAFT_142009 [Fomitopsis pinicola FP-58527 SS1] Length = 220 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/43 (58%), Positives = 30/43 (69%) Frame = +1 Query: 181 WRAVTQKYPLLKLSVYTLYWVPTAIVFTEYFYTVKSIRGRSMQ 309 WR + LK ++Y L W+PT IVFTE FYTVKS+ GRSMQ Sbjct: 12 WRTFWGAHRTLKRALYPLVWLPTGIVFTELFYTVKSVNGRSMQ 54