BLASTX nr result
ID: Paeonia25_contig00037568
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00037568 (239 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002509652.1| cytochrome P450, putative [Ricinus communis]... 60 4e-07 ref|XP_002271420.2| PREDICTED: LOW QUALITY PROTEIN: cytochrome P... 59 5e-07 ref|XP_002301307.2| cytochrome P450 family protein [Populus tric... 59 7e-07 ref|XP_003633930.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P... 58 1e-06 ref|XP_002271652.1| PREDICTED: cytochrome P450 76C4 [Vitis vinif... 58 1e-06 emb|CAN75686.1| hypothetical protein VITISV_010578 [Vitis vinifera] 58 1e-06 ref|XP_002276576.1| PREDICTED: cytochrome P450 76C4 [Vitis vinif... 58 2e-06 emb|CBI38804.3| unnamed protein product [Vitis vinifera] 57 2e-06 ref|XP_002276121.1| PREDICTED: cytochrome P450 76C4-like [Vitis ... 57 2e-06 ref|XP_002271323.1| PREDICTED: cytochrome P450 76C1-like [Vitis ... 57 3e-06 emb|CAN81641.1| hypothetical protein VITISV_036425 [Vitis vinifera] 57 3e-06 ref|XP_002301305.2| cytochrome P450 family protein [Populus tric... 56 5e-06 ref|XP_003589660.1| Cytochrome P450 monooxygenase [Medicago trun... 56 5e-06 gb|ACI90295.1| cytochrome P450 monoxygenase, partial [Picrorhiza... 56 5e-06 ref|XP_002509653.1| cytochrome P450, putative [Ricinus communis]... 56 5e-06 ref|XP_006477331.1| PREDICTED: geraniol 8-hydroxylase-like [Citr... 56 6e-06 ref|XP_002299579.2| hypothetical protein POPTR_0001s08320g [Popu... 56 6e-06 ref|XP_002301306.2| hypothetical protein POPTR_0002s15150g [Popu... 56 6e-06 ref|XP_002301302.2| hypothetical protein POPTR_0002s15110g [Popu... 56 6e-06 ref|XP_006388387.1| hypothetical protein POPTR_0201s00200g [Popu... 56 6e-06 >ref|XP_002509652.1| cytochrome P450, putative [Ricinus communis] gi|223549551|gb|EEF51039.1| cytochrome P450, putative [Ricinus communis] Length = 377 Score = 59.7 bits (143), Expect = 4e-07 Identities = 23/36 (63%), Positives = 32/36 (88%) Frame = -3 Query: 237 FDWKLEKGMTPEEMDMSDKYGLSIHKAEPLRAIPMK 130 FDWKLE G+TPE MDM DK+G+++ KA+PL+AIP++ Sbjct: 341 FDWKLENGVTPESMDMEDKFGITLQKAQPLKAIPIQ 376 >ref|XP_002271420.2| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 76C4-like [Vitis vinifera] Length = 498 Score = 59.3 bits (142), Expect = 5e-07 Identities = 23/36 (63%), Positives = 33/36 (91%) Frame = -3 Query: 237 FDWKLEKGMTPEEMDMSDKYGLSIHKAEPLRAIPMK 130 FDWKLE G+ PE+MDMS+K+G+++ KA+PLRAIP++ Sbjct: 462 FDWKLEDGLKPEDMDMSEKFGITLQKAKPLRAIPIR 497 >ref|XP_002301307.2| cytochrome P450 family protein [Populus trichocarpa] gi|550345063|gb|EEE80580.2| cytochrome P450 family protein [Populus trichocarpa] Length = 496 Score = 58.9 bits (141), Expect = 7e-07 Identities = 23/36 (63%), Positives = 32/36 (88%) Frame = -3 Query: 237 FDWKLEKGMTPEEMDMSDKYGLSIHKAEPLRAIPMK 130 FDWK+ +TPE++DMS+ +GL++HK+EPLRAIPMK Sbjct: 460 FDWKIADDLTPEDIDMSETFGLTLHKSEPLRAIPMK 495 >ref|XP_003633930.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 76C4-like [Vitis vinifera] Length = 493 Score = 58.2 bits (139), Expect = 1e-06 Identities = 22/36 (61%), Positives = 32/36 (88%) Frame = -3 Query: 237 FDWKLEKGMTPEEMDMSDKYGLSIHKAEPLRAIPMK 130 FDWKLE GM PE+MDM++K+G ++ KA+PL+A+P+K Sbjct: 457 FDWKLEDGMKPEDMDMTEKFGFTLRKAQPLQAVPIK 492 >ref|XP_002271652.1| PREDICTED: cytochrome P450 76C4 [Vitis vinifera] Length = 499 Score = 58.2 bits (139), Expect = 1e-06 Identities = 23/36 (63%), Positives = 30/36 (83%) Frame = -3 Query: 237 FDWKLEKGMTPEEMDMSDKYGLSIHKAEPLRAIPMK 130 FDWKLE GM PE+MDMS+ +G S+ KA+PLR +P+K Sbjct: 463 FDWKLEGGMKPEDMDMSETFGFSVRKAQPLRVVPIK 498 >emb|CAN75686.1| hypothetical protein VITISV_010578 [Vitis vinifera] Length = 499 Score = 58.2 bits (139), Expect = 1e-06 Identities = 23/36 (63%), Positives = 30/36 (83%) Frame = -3 Query: 237 FDWKLEKGMTPEEMDMSDKYGLSIHKAEPLRAIPMK 130 FDWKLE GM PE+MDMS+ +G S+ KA+PLR +P+K Sbjct: 463 FDWKLEGGMKPEDMDMSEXFGFSVRKAQPLRVVPIK 498 >ref|XP_002276576.1| PREDICTED: cytochrome P450 76C4 [Vitis vinifera] Length = 499 Score = 57.8 bits (138), Expect = 2e-06 Identities = 23/36 (63%), Positives = 30/36 (83%) Frame = -3 Query: 237 FDWKLEKGMTPEEMDMSDKYGLSIHKAEPLRAIPMK 130 FDWKLE M PE+MDMS+K+G ++ KA+PLRA+P K Sbjct: 463 FDWKLEDSMRPEDMDMSEKFGFTLRKAQPLRAVPTK 498 >emb|CBI38804.3| unnamed protein product [Vitis vinifera] Length = 113 Score = 57.4 bits (137), Expect = 2e-06 Identities = 21/36 (58%), Positives = 33/36 (91%) Frame = -3 Query: 237 FDWKLEKGMTPEEMDMSDKYGLSIHKAEPLRAIPMK 130 FDWKL+ G+ PE+MDM++K+GL++ KA+PL+A+P+K Sbjct: 77 FDWKLQDGLKPEDMDMTEKFGLTLRKAQPLQAVPIK 112 >ref|XP_002276121.1| PREDICTED: cytochrome P450 76C4-like [Vitis vinifera] Length = 465 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = -3 Query: 231 WKLEKGMTPEEMDMSDKYGLSIHKAEPLRAIPMK 130 WKLE GM PE MDMS+K+GL++ KA+PLRAIP+K Sbjct: 431 WKLEDGMKPENMDMSEKFGLTLQKAQPLRAIPIK 464 >ref|XP_002271323.1| PREDICTED: cytochrome P450 76C1-like [Vitis vinifera] Length = 471 Score = 57.0 bits (136), Expect = 3e-06 Identities = 21/36 (58%), Positives = 32/36 (88%) Frame = -3 Query: 237 FDWKLEKGMTPEEMDMSDKYGLSIHKAEPLRAIPMK 130 FDWKLE G+ PE+MDM++K+G ++ KA+PL+A+P+K Sbjct: 435 FDWKLEDGLKPEDMDMTEKFGFTLRKAQPLQAVPIK 470 >emb|CAN81641.1| hypothetical protein VITISV_036425 [Vitis vinifera] Length = 473 Score = 57.0 bits (136), Expect = 3e-06 Identities = 21/36 (58%), Positives = 32/36 (88%) Frame = -3 Query: 237 FDWKLEKGMTPEEMDMSDKYGLSIHKAEPLRAIPMK 130 FDWKLE G+ PE+MDM++K+G ++ KA+PL+A+P+K Sbjct: 437 FDWKLEDGLKPEDMDMTEKFGFTLRKAQPLQAVPIK 472 >ref|XP_002301305.2| cytochrome P450 family protein [Populus trichocarpa] gi|550345061|gb|EEE80578.2| cytochrome P450 family protein [Populus trichocarpa] Length = 500 Score = 56.2 bits (134), Expect = 5e-06 Identities = 22/36 (61%), Positives = 31/36 (86%) Frame = -3 Query: 237 FDWKLEKGMTPEEMDMSDKYGLSIHKAEPLRAIPMK 130 FDWK+ +TPE++D S+ +GL++HK+EPLRAIPMK Sbjct: 464 FDWKIAGDLTPEDIDTSETFGLTLHKSEPLRAIPMK 499 >ref|XP_003589660.1| Cytochrome P450 monooxygenase [Medicago truncatula] gi|355478708|gb|AES59911.1| Cytochrome P450 monooxygenase [Medicago truncatula] Length = 499 Score = 56.2 bits (134), Expect = 5e-06 Identities = 21/36 (58%), Positives = 31/36 (86%) Frame = -3 Query: 237 FDWKLEKGMTPEEMDMSDKYGLSIHKAEPLRAIPMK 130 FDW+LE GM PE+M+M DK+G+++ KA+PLR +P+K Sbjct: 461 FDWELEGGMKPEDMNMDDKFGITLQKAQPLRIVPLK 496 >gb|ACI90295.1| cytochrome P450 monoxygenase, partial [Picrorhiza kurrooa] Length = 206 Score = 56.2 bits (134), Expect = 5e-06 Identities = 21/36 (58%), Positives = 33/36 (91%) Frame = -3 Query: 237 FDWKLEKGMTPEEMDMSDKYGLSIHKAEPLRAIPMK 130 FDW+LE G+TPE++D+SD++GLS+ KA PL+A+P++ Sbjct: 170 FDWRLEPGITPEQVDISDRFGLSLQKAMPLKALPVR 205 >ref|XP_002509653.1| cytochrome P450, putative [Ricinus communis] gi|223549552|gb|EEF51040.1| cytochrome P450, putative [Ricinus communis] Length = 501 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/34 (67%), Positives = 29/34 (85%) Frame = -3 Query: 237 FDWKLEKGMTPEEMDMSDKYGLSIHKAEPLRAIP 136 FDWKLE G+TPE MDM D++G+S+ KA+PL AIP Sbjct: 465 FDWKLEDGVTPENMDMEDRFGISLQKAKPLIAIP 498 >ref|XP_006477331.1| PREDICTED: geraniol 8-hydroxylase-like [Citrus sinensis] Length = 499 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/35 (62%), Positives = 30/35 (85%) Frame = -3 Query: 237 FDWKLEKGMTPEEMDMSDKYGLSIHKAEPLRAIPM 133 FDWKLE G+TPE +DM +K+GL++ KA PLRA+P+ Sbjct: 463 FDWKLEDGVTPETIDMEEKFGLTLQKARPLRALPI 497 >ref|XP_002299579.2| hypothetical protein POPTR_0001s08320g [Populus trichocarpa] gi|550346829|gb|EEE84384.2| hypothetical protein POPTR_0001s08320g [Populus trichocarpa] Length = 502 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/36 (61%), Positives = 30/36 (83%) Frame = -3 Query: 237 FDWKLEKGMTPEEMDMSDKYGLSIHKAEPLRAIPMK 130 FDWKLE G+TPE MDM DK+G+++ KA LRA+P++ Sbjct: 466 FDWKLENGVTPESMDMEDKFGITLGKARSLRAVPIQ 501 >ref|XP_002301306.2| hypothetical protein POPTR_0002s15150g [Populus trichocarpa] gi|550345062|gb|EEE80579.2| hypothetical protein POPTR_0002s15150g [Populus trichocarpa] Length = 496 Score = 55.8 bits (133), Expect = 6e-06 Identities = 21/36 (58%), Positives = 31/36 (86%) Frame = -3 Query: 237 FDWKLEKGMTPEEMDMSDKYGLSIHKAEPLRAIPMK 130 FDWK+ +TPE++D S+ +G+++HK+EPLRAIPMK Sbjct: 460 FDWKIADDLTPEDIDTSETFGITLHKSEPLRAIPMK 495 >ref|XP_002301302.2| hypothetical protein POPTR_0002s15110g [Populus trichocarpa] gi|550345058|gb|EEE80575.2| hypothetical protein POPTR_0002s15110g [Populus trichocarpa] Length = 430 Score = 55.8 bits (133), Expect = 6e-06 Identities = 21/36 (58%), Positives = 31/36 (86%) Frame = -3 Query: 237 FDWKLEKGMTPEEMDMSDKYGLSIHKAEPLRAIPMK 130 FDWK+ +TPE++D+S+ +G ++HK+EPLRAIPMK Sbjct: 394 FDWKIADDLTPEDIDISETFGFTLHKSEPLRAIPMK 429 >ref|XP_006388387.1| hypothetical protein POPTR_0201s00200g [Populus trichocarpa] gi|550310112|gb|ERP47301.1| hypothetical protein POPTR_0201s00200g [Populus trichocarpa] Length = 496 Score = 55.8 bits (133), Expect = 6e-06 Identities = 21/36 (58%), Positives = 31/36 (86%) Frame = -3 Query: 237 FDWKLEKGMTPEEMDMSDKYGLSIHKAEPLRAIPMK 130 FDWK+ +TPE++D S+ +G+++HK+EPLRAIPMK Sbjct: 460 FDWKIADDLTPEDIDTSETFGITLHKSEPLRAIPMK 495