BLASTX nr result
ID: Paeonia25_contig00037191
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00037191 (742 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPT02502.1| hypothetical protein FOMPIDRAFT_1047857 [Fomitops... 59 2e-06 >gb|EPT02502.1| hypothetical protein FOMPIDRAFT_1047857 [Fomitopsis pinicola FP-58527 SS1] Length = 504 Score = 58.9 bits (141), Expect = 2e-06 Identities = 38/126 (30%), Positives = 67/126 (53%), Gaps = 5/126 (3%) Frame = -3 Query: 740 HIYHLDWTKRSPHQTFSAMLSQFRSVRRLKLVDCKFRTFQQFQRLISVLPCLTSMNRTG- 564 H+ L RS H T+ A L Q +VR L L C ++F +FQRL+ P L ++ G Sbjct: 121 HLSFLCCRLRSLHPTYFARLPQLANVRSLSLDTCHLKSFSEFQRLVCAFPLLEELHLKGS 180 Query: 563 --WKEKPQEMSLPQWLNRTNSLIRLPQFTEIVLQLTDRSLRPIAPLFAWLSHTPST--KS 396 + ++P+++ P R +S++R P+ T ++++ + + + L WL+ T +T S Sbjct: 181 VIYGQRPRDLQSPLLPGR-HSVLRAPRLT--LIRMNELRMELVHALVVWLTMTSTTALSS 237 Query: 395 LRRLTL 378 LR L + Sbjct: 238 LRALDI 243