BLASTX nr result
ID: Paeonia25_contig00037187
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00037187 (444 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007144199.1| hypothetical protein PHAVU_007G136600g, part... 48 2e-08 ref|XP_006381681.1| hypothetical protein POPTR_0006s15620g, part... 43 1e-07 ref|XP_006376061.1| hypothetical protein POPTR_0013s08563g [Popu... 47 1e-07 ref|XP_007138784.1| hypothetical protein PHAVU_009G237300g, part... 50 3e-07 ref|XP_006370022.1| hypothetical protein POPTR_0001s38125g [Popu... 42 8e-06 >ref|XP_007144199.1| hypothetical protein PHAVU_007G136600g, partial [Phaseolus vulgaris] gi|561017389|gb|ESW16193.1| hypothetical protein PHAVU_007G136600g, partial [Phaseolus vulgaris] Length = 491 Score = 47.8 bits (112), Expect(2) = 2e-08 Identities = 23/64 (35%), Positives = 36/64 (56%) Frame = +2 Query: 167 YHYASNFEPIGDIMKGLYDMIERMFTDRKLRQLIDK*LDIFGNTKLNFGMEMAI*MRDKN 346 YH+ NF P +++ GLY+ + M D ++R ID+ L+ K FGM+MAI R+ Sbjct: 358 YHHDKNFNPDSEVLVGLYETFQIMVLDARIRVAIDQQLEKSKGAKRLFGMDMAIDSRNMK 417 Query: 347 NQVK 358 +K Sbjct: 418 QPIK 421 Score = 36.6 bits (83), Expect(2) = 2e-08 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 13 RWDLQLHKQLHAAGYYLNSR 72 RW+LQLH+ LH A YYLN R Sbjct: 338 RWNLQLHRPLHVAAYYLNPR 357 >ref|XP_006381681.1| hypothetical protein POPTR_0006s15620g, partial [Populus trichocarpa] gi|550336412|gb|ERP59478.1| hypothetical protein POPTR_0006s15620g, partial [Populus trichocarpa] Length = 576 Score = 42.7 bits (99), Expect(2) = 1e-07 Identities = 25/61 (40%), Positives = 33/61 (54%) Frame = +2 Query: 167 YHYASNFEPIGDIMKGLYDMIERMFTDRKLRQLIDK*LDIFGNTKLNFGMEMAI*MRDKN 346 YHY NF+ +I GLY +ERM + R ID L+ F + K FG++ A RDK Sbjct: 474 YHYNPNFKVNANIKIGLYQCLERMVPNANERCKIDLQLESFKDAKGLFGIDAAKTARDKK 533 Query: 347 N 349 N Sbjct: 534 N 534 Score = 38.5 bits (88), Expect(2) = 1e-07 Identities = 15/21 (71%), Positives = 18/21 (85%) Frame = +1 Query: 4 MNKRWDLQLHKQLHAAGYYLN 66 ++ RW+LQLHK LHAA YYLN Sbjct: 451 VDARWELQLHKPLHAAAYYLN 471 >ref|XP_006376061.1| hypothetical protein POPTR_0013s08563g [Populus trichocarpa] gi|550325295|gb|ERP53858.1| hypothetical protein POPTR_0013s08563g [Populus trichocarpa] Length = 322 Score = 47.4 bits (111), Expect(2) = 1e-07 Identities = 28/61 (45%), Positives = 33/61 (54%) Frame = +2 Query: 167 YHYASNFEPIGDIMKGLYDMIERMFTDRKLRQLIDK*LDIFGNTKLNFGMEMAI*MRDKN 346 YHY SNF+ +I GLY +ERM D R ID LD F + FG+E A RDK Sbjct: 260 YHYNSNFKVNANIKIGLYQCLERMVPDSSERCKIDLQLDSFKDANGLFGIEAAKITRDKK 319 Query: 347 N 349 N Sbjct: 320 N 320 Score = 33.9 bits (76), Expect(2) = 1e-07 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +1 Query: 4 MNKRWDLQLHKQLHAAGYYLN 66 ++ RW+ QLHK LH YYLN Sbjct: 237 IDARWEFQLHKPLHVTAYYLN 257 >ref|XP_007138784.1| hypothetical protein PHAVU_009G237300g, partial [Phaseolus vulgaris] gi|561011871|gb|ESW10778.1| hypothetical protein PHAVU_009G237300g, partial [Phaseolus vulgaris] Length = 397 Score = 49.7 bits (117), Expect(2) = 3e-07 Identities = 24/58 (41%), Positives = 32/58 (55%) Frame = +2 Query: 155 FGYIYHYASNFEPIGDIMKGLYDMIERMFTDRKLRQLIDK*LDIFGNTKLNFGMEMAI 328 F YHY F P ++M GLY+ +RM +D + R ID+ L+ F K FGM M I Sbjct: 338 FNLRYHYEKKFNPHSEVMVGLYETFQRMVSDARTRVAIDQQLEKFKGAKGLFGMNMTI 395 Score = 30.4 bits (67), Expect(2) = 3e-07 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +1 Query: 4 MNKRWDLQLHKQLHAAGYYLNSR 72 ++ RW+L LH+ L+A YY N R Sbjct: 319 IDTRWNLPLHRPLYATAYYFNLR 341 >ref|XP_006370022.1| hypothetical protein POPTR_0001s38125g [Populus trichocarpa] gi|550349152|gb|ERP66591.1| hypothetical protein POPTR_0001s38125g [Populus trichocarpa] Length = 762 Score = 42.0 bits (97), Expect(2) = 8e-06 Identities = 26/64 (40%), Positives = 33/64 (51%) Frame = +2 Query: 167 YHYASNFEPIGDIMKGLYDMIERMFTDRKLRQLIDK*LDIFGNTKLNFGMEMAI*MRDKN 346 YHY SNF+ +I GLY +ERM + R ID LD F + FG++ A RDK Sbjct: 457 YHYNSNFKVNANIKIGLYQCLERMVPNAIERCKIDLQLDSFKDASGLFGIKAAKITRDKK 516 Query: 347 NQVK 358 K Sbjct: 517 TPAK 520 Score = 33.1 bits (74), Expect(2) = 8e-06 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = +1 Query: 4 MNKRWDLQLHKQLHAAGYYLN 66 ++ RW+LQLH LH A YYLN Sbjct: 434 IDARWELQLHIPLHVATYYLN 454