BLASTX nr result
ID: Paeonia25_contig00037139
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00037139 (244 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006385630.1| hypothetical protein POPTR_0003s08810g, part... 60 4e-07 ref|XP_004148492.1| PREDICTED: protein ABCI7, chloroplastic-like... 57 2e-06 ref|XP_002278544.1| PREDICTED: protein ABCI7, chloroplastic-like... 55 8e-06 emb|CBI33903.3| unnamed protein product [Vitis vinifera] 55 8e-06 emb|CAN69419.1| hypothetical protein VITISV_028794 [Vitis vinifera] 55 8e-06 >ref|XP_006385630.1| hypothetical protein POPTR_0003s08810g, partial [Populus trichocarpa] gi|550342760|gb|ERP63427.1| hypothetical protein POPTR_0003s08810g, partial [Populus trichocarpa] Length = 193 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -1 Query: 244 ETARKALVFSFGAEVIERLPYPFIRKKVENRIK 146 ETARKALVFSFGAEVIE+LPY FIRK+VEN +K Sbjct: 149 ETARKALVFSFGAEVIEKLPYSFIRKQVENHVK 181 >ref|XP_004148492.1| PREDICTED: protein ABCI7, chloroplastic-like [Cucumis sativus] gi|449521999|ref|XP_004168016.1| PREDICTED: protein ABCI7, chloroplastic-like [Cucumis sativus] Length = 496 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -1 Query: 244 ETARKALVFSFGAEVIERLPYPFIRKKVENRIK 146 ETARKAL+FSFGAEVIERLP P +RK+VEN IK Sbjct: 454 ETARKALIFSFGAEVIERLPSPSVRKRVENHIK 486 >ref|XP_002278544.1| PREDICTED: protein ABCI7, chloroplastic-like [Vitis vinifera] Length = 495 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = -1 Query: 244 ETARKALVFSFGAEVIERLPYPFIRKKVENRIK 146 ETARKAL+FSFG EVIERLPY IRKKVE IK Sbjct: 452 ETARKALIFSFGGEVIERLPYSSIRKKVETHIK 484 >emb|CBI33903.3| unnamed protein product [Vitis vinifera] Length = 480 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = -1 Query: 244 ETARKALVFSFGAEVIERLPYPFIRKKVENRIK 146 ETARKAL+FSFG EVIERLPY IRKKVE IK Sbjct: 437 ETARKALIFSFGGEVIERLPYSSIRKKVETHIK 469 >emb|CAN69419.1| hypothetical protein VITISV_028794 [Vitis vinifera] Length = 593 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = -1 Query: 244 ETARKALVFSFGAEVIERLPYPFIRKKVENRIK 146 ETARKAL+FSFG EVIERLPY IRKKVE IK Sbjct: 452 ETARKALIFSFGGEVIERLPYSSIRKKVETHIK 484