BLASTX nr result
ID: Paeonia25_contig00037064
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00037064 (240 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN68884.1| hypothetical protein VITISV_039230 [Vitis vinifera] 60 2e-07 >emb|CAN68884.1| hypothetical protein VITISV_039230 [Vitis vinifera] Length = 220 Score = 60.5 bits (145), Expect = 2e-07 Identities = 32/64 (50%), Positives = 47/64 (73%), Gaps = 3/64 (4%) Frame = -1 Query: 240 VQIRMCDVIVRTLTDVQHVREEEPDFS*HFSI---GCSYKAEGGVIRISRCVLVVMKGKR 70 ++I+M D +RTLTDV+HV + + + ++ GC+YKAEGGV+RIS+ LVVMKGK+ Sbjct: 113 IRIKMYDGFIRTLTDVRHVPKLKKNLISLGTLDSNGCTYKAEGGVLRISKGALVVMKGKK 172 Query: 69 EHGL 58 +GL Sbjct: 173 INGL 176