BLASTX nr result
ID: Paeonia25_contig00036215
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00036215 (302 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007034201.1| Pentatricopeptide repeat (PPR) superfamily p... 139 5e-31 ref|XP_006492529.1| PREDICTED: pentatricopeptide repeat-containi... 134 1e-29 ref|XP_006492528.1| PREDICTED: pentatricopeptide repeat-containi... 134 1e-29 ref|XP_007221312.1| hypothetical protein PRUPE_ppa026098mg [Prun... 134 2e-29 ref|XP_006421034.1| hypothetical protein CICLE_v10004567mg [Citr... 133 2e-29 ref|XP_004156841.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 132 4e-29 ref|XP_004152256.1| PREDICTED: pentatricopeptide repeat-containi... 132 4e-29 ref|XP_003537521.1| PREDICTED: pentatricopeptide repeat-containi... 132 4e-29 ref|XP_004502251.1| PREDICTED: pentatricopeptide repeat-containi... 131 1e-28 ref|XP_004297007.1| PREDICTED: pentatricopeptide repeat-containi... 130 2e-28 emb|CBI30100.3| unnamed protein product [Vitis vinifera] 129 3e-28 ref|XP_002278647.1| PREDICTED: pentatricopeptide repeat-containi... 129 3e-28 ref|XP_007163806.1| hypothetical protein PHAVU_001G265800g [Phas... 128 7e-28 ref|XP_006360920.1| PREDICTED: pentatricopeptide repeat-containi... 127 1e-27 ref|XP_002298671.2| pentatricopeptide repeat-containing family p... 127 2e-27 ref|XP_004247893.1| PREDICTED: pentatricopeptide repeat-containi... 127 2e-27 ref|XP_003601696.1| Pentatricopeptide repeat-containing protein ... 126 4e-27 gb|EYU31519.1| hypothetical protein MIMGU_mgv1a003519mg [Mimulus... 125 8e-27 ref|XP_006283355.1| hypothetical protein CARUB_v10004398mg [Caps... 125 8e-27 ref|NP_193141.2| pentatricopeptide repeat-containing protein [Ar... 125 8e-27 >ref|XP_007034201.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] gi|508713230|gb|EOY05127.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] Length = 610 Score = 139 bits (349), Expect = 5e-31 Identities = 61/70 (87%), Positives = 66/70 (94%) Frame = -1 Query: 302 WHSERLAVAYGLLKDVPGTVIQVVKNLRVCGDCHTVLKFICSIKKREIIVRDATRFHHFK 123 WHSERLAVAYGLLK VPGTVI++VKNLRVCGDCHTVLKFI +I KREI+VRDA R+HHFK Sbjct: 541 WHSERLAVAYGLLKGVPGTVIRIVKNLRVCGDCHTVLKFISNIAKREIVVRDAKRYHHFK 600 Query: 122 DGNCSCNDFW 93 DGNCSCNDFW Sbjct: 601 DGNCSCNDFW 610 >ref|XP_006492529.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14050, mitochondrial-like isoform X2 [Citrus sinensis] Length = 610 Score = 134 bits (338), Expect = 1e-29 Identities = 59/70 (84%), Positives = 64/70 (91%) Frame = -1 Query: 302 WHSERLAVAYGLLKDVPGTVIQVVKNLRVCGDCHTVLKFICSIKKREIIVRDATRFHHFK 123 WHSERLAVAYGLLK VPGTV++VVKNLRVCGDCH V+K I SI KREI+VRDATR+HHFK Sbjct: 541 WHSERLAVAYGLLKSVPGTVLRVVKNLRVCGDCHIVMKMISSITKREIVVRDATRYHHFK 600 Query: 122 DGNCSCNDFW 93 DG CSCNDFW Sbjct: 601 DGKCSCNDFW 610 >ref|XP_006492528.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14050, mitochondrial-like isoform X1 [Citrus sinensis] Length = 623 Score = 134 bits (338), Expect = 1e-29 Identities = 59/70 (84%), Positives = 64/70 (91%) Frame = -1 Query: 302 WHSERLAVAYGLLKDVPGTVIQVVKNLRVCGDCHTVLKFICSIKKREIIVRDATRFHHFK 123 WHSERLAVAYGLLK VPGTV++VVKNLRVCGDCH V+K I SI KREI+VRDATR+HHFK Sbjct: 541 WHSERLAVAYGLLKSVPGTVLRVVKNLRVCGDCHIVMKMISSITKREIVVRDATRYHHFK 600 Query: 122 DGNCSCNDFW 93 DG CSCNDFW Sbjct: 601 DGKCSCNDFW 610 >ref|XP_007221312.1| hypothetical protein PRUPE_ppa026098mg [Prunus persica] gi|462417946|gb|EMJ22511.1| hypothetical protein PRUPE_ppa026098mg [Prunus persica] Length = 610 Score = 134 bits (336), Expect = 2e-29 Identities = 59/70 (84%), Positives = 64/70 (91%) Frame = -1 Query: 302 WHSERLAVAYGLLKDVPGTVIQVVKNLRVCGDCHTVLKFICSIKKREIIVRDATRFHHFK 123 WHSERLAVAYGLLK VPGTVI++VKNLRVCGDCHTVLKFI SI KR+I+VRDATR+HHF Sbjct: 541 WHSERLAVAYGLLKAVPGTVIRIVKNLRVCGDCHTVLKFISSIVKRDIVVRDATRYHHFS 600 Query: 122 DGNCSCNDFW 93 G CSCNDFW Sbjct: 601 SGECSCNDFW 610 >ref|XP_006421034.1| hypothetical protein CICLE_v10004567mg [Citrus clementina] gi|557522907|gb|ESR34274.1| hypothetical protein CICLE_v10004567mg [Citrus clementina] Length = 610 Score = 133 bits (335), Expect = 2e-29 Identities = 58/70 (82%), Positives = 64/70 (91%) Frame = -1 Query: 302 WHSERLAVAYGLLKDVPGTVIQVVKNLRVCGDCHTVLKFICSIKKREIIVRDATRFHHFK 123 WHSERLAVAYGLLK VPGTV++VVKNLRVCGDCH V+K I +I KREI+VRDATR+HHFK Sbjct: 541 WHSERLAVAYGLLKSVPGTVLRVVKNLRVCGDCHIVMKMISNITKREIVVRDATRYHHFK 600 Query: 122 DGNCSCNDFW 93 DG CSCNDFW Sbjct: 601 DGKCSCNDFW 610 >ref|XP_004156841.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At4g14050, mitochondrial-like [Cucumis sativus] Length = 611 Score = 132 bits (333), Expect = 4e-29 Identities = 57/70 (81%), Positives = 64/70 (91%) Frame = -1 Query: 302 WHSERLAVAYGLLKDVPGTVIQVVKNLRVCGDCHTVLKFICSIKKREIIVRDATRFHHFK 123 WHSERLAVAYGLLK VPGT+I++VKNLR+CGDCH VLKFI I KREI+VRDATR+HHFK Sbjct: 542 WHSERLAVAYGLLKAVPGTIIRIVKNLRICGDCHNVLKFISDIVKREIMVRDATRYHHFK 601 Query: 122 DGNCSCNDFW 93 +G CSCNDFW Sbjct: 602 EGKCSCNDFW 611 >ref|XP_004152256.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14050, mitochondrial-like [Cucumis sativus] Length = 611 Score = 132 bits (333), Expect = 4e-29 Identities = 57/70 (81%), Positives = 64/70 (91%) Frame = -1 Query: 302 WHSERLAVAYGLLKDVPGTVIQVVKNLRVCGDCHTVLKFICSIKKREIIVRDATRFHHFK 123 WHSERLAVAYGLLK VPGT+I++VKNLR+CGDCH VLKFI I KREI+VRDATR+HHFK Sbjct: 542 WHSERLAVAYGLLKAVPGTIIRIVKNLRICGDCHNVLKFISDIVKREIMVRDATRYHHFK 601 Query: 122 DGNCSCNDFW 93 +G CSCNDFW Sbjct: 602 EGKCSCNDFW 611 >ref|XP_003537521.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14050, mitochondrial-like [Glycine max] Length = 611 Score = 132 bits (333), Expect = 4e-29 Identities = 59/70 (84%), Positives = 63/70 (90%) Frame = -1 Query: 302 WHSERLAVAYGLLKDVPGTVIQVVKNLRVCGDCHTVLKFICSIKKREIIVRDATRFHHFK 123 WHSERLAVAYGLLK VPGTVI++VKNLRVCGDCHTVLK I +I REI VRDA R+HHFK Sbjct: 542 WHSERLAVAYGLLKAVPGTVIRIVKNLRVCGDCHTVLKLISAITNREIYVRDAKRYHHFK 601 Query: 122 DGNCSCNDFW 93 DGNCSCNDFW Sbjct: 602 DGNCSCNDFW 611 >ref|XP_004502251.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14050, mitochondrial-like isoform X1 [Cicer arietinum] gi|502135197|ref|XP_004502252.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14050, mitochondrial-like isoform X2 [Cicer arietinum] gi|502135202|ref|XP_004502253.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14050, mitochondrial-like isoform X3 [Cicer arietinum] gi|502135205|ref|XP_004502254.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14050, mitochondrial-like isoform X4 [Cicer arietinum] Length = 616 Score = 131 bits (329), Expect = 1e-28 Identities = 57/70 (81%), Positives = 63/70 (90%) Frame = -1 Query: 302 WHSERLAVAYGLLKDVPGTVIQVVKNLRVCGDCHTVLKFICSIKKREIIVRDATRFHHFK 123 WHSERLA+AYGLLK VPGT+I++VKNLRVCGDCHTVLK I +I REI VRDA R+HHFK Sbjct: 547 WHSERLALAYGLLKAVPGTIIRIVKNLRVCGDCHTVLKLISTITSREIYVRDAKRYHHFK 606 Query: 122 DGNCSCNDFW 93 DGNCSCNDFW Sbjct: 607 DGNCSCNDFW 616 >ref|XP_004297007.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14050, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 610 Score = 130 bits (327), Expect = 2e-28 Identities = 58/70 (82%), Positives = 63/70 (90%) Frame = -1 Query: 302 WHSERLAVAYGLLKDVPGTVIQVVKNLRVCGDCHTVLKFICSIKKREIIVRDATRFHHFK 123 WHSERLA+AYGLLK VPGT I++VKNLRVCGDCHTVLKFI SI KR+IIVRDATR+HHF Sbjct: 541 WHSERLALAYGLLKAVPGTPIRIVKNLRVCGDCHTVLKFISSIVKRDIIVRDATRYHHFS 600 Query: 122 DGNCSCNDFW 93 G CSCNDFW Sbjct: 601 KGECSCNDFW 610 >emb|CBI30100.3| unnamed protein product [Vitis vinifera] Length = 194 Score = 129 bits (325), Expect = 3e-28 Identities = 56/70 (80%), Positives = 62/70 (88%) Frame = -1 Query: 302 WHSERLAVAYGLLKDVPGTVIQVVKNLRVCGDCHTVLKFICSIKKREIIVRDATRFHHFK 123 WHSERLAVAYGLLK +PG V+ +VKNLRVCGDCHTVLKFI I KREI+VRDA R+HHFK Sbjct: 125 WHSERLAVAYGLLKGIPGMVLHIVKNLRVCGDCHTVLKFISIIVKREIVVRDANRYHHFK 184 Query: 122 DGNCSCNDFW 93 DG CSCN+FW Sbjct: 185 DGKCSCNNFW 194 >ref|XP_002278647.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14050, mitochondrial-like [Vitis vinifera] Length = 610 Score = 129 bits (325), Expect = 3e-28 Identities = 56/70 (80%), Positives = 62/70 (88%) Frame = -1 Query: 302 WHSERLAVAYGLLKDVPGTVIQVVKNLRVCGDCHTVLKFICSIKKREIIVRDATRFHHFK 123 WHSERLAVAYGLLK +PG V+ +VKNLRVCGDCHTVLKFI I KREI+VRDA R+HHFK Sbjct: 541 WHSERLAVAYGLLKGIPGMVLHIVKNLRVCGDCHTVLKFISIIVKREIVVRDANRYHHFK 600 Query: 122 DGNCSCNDFW 93 DG CSCN+FW Sbjct: 601 DGKCSCNNFW 610 >ref|XP_007163806.1| hypothetical protein PHAVU_001G265800g [Phaseolus vulgaris] gi|561037270|gb|ESW35800.1| hypothetical protein PHAVU_001G265800g [Phaseolus vulgaris] Length = 611 Score = 128 bits (322), Expect = 7e-28 Identities = 56/70 (80%), Positives = 63/70 (90%) Frame = -1 Query: 302 WHSERLAVAYGLLKDVPGTVIQVVKNLRVCGDCHTVLKFICSIKKREIIVRDATRFHHFK 123 WHSERLAVAYGLLK VPGT+I++VKNLRVCGDCHTVLK I +I REI VRDA R+HHFK Sbjct: 542 WHSERLAVAYGLLKAVPGTIIRIVKNLRVCGDCHTVLKLISTITNREIYVRDAKRYHHFK 601 Query: 122 DGNCSCNDFW 93 DG+CSC+DFW Sbjct: 602 DGSCSCHDFW 611 >ref|XP_006360920.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14050, mitochondrial-like [Solanum tuberosum] Length = 610 Score = 127 bits (320), Expect = 1e-27 Identities = 53/70 (75%), Positives = 63/70 (90%) Frame = -1 Query: 302 WHSERLAVAYGLLKDVPGTVIQVVKNLRVCGDCHTVLKFICSIKKREIIVRDATRFHHFK 123 WHSERLAVAYG+L+ VPG+VI+VVKNLR+CGDCHTV+KFI SI R+I++RDA RFHHF Sbjct: 541 WHSERLAVAYGILRTVPGSVIRVVKNLRICGDCHTVIKFISSITNRKIVIRDANRFHHFN 600 Query: 122 DGNCSCNDFW 93 +G CSCNDFW Sbjct: 601 EGTCSCNDFW 610 >ref|XP_002298671.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550348740|gb|EEE83476.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 634 Score = 127 bits (319), Expect = 2e-27 Identities = 56/70 (80%), Positives = 61/70 (87%) Frame = -1 Query: 302 WHSERLAVAYGLLKDVPGTVIQVVKNLRVCGDCHTVLKFICSIKKREIIVRDATRFHHFK 123 WHSER AVAYGLLK VPGTVI++VKNLR+CGDCHT LK SI +EIIVRDATR+HHFK Sbjct: 565 WHSERWAVAYGLLKAVPGTVIRIVKNLRICGDCHTFLKLTSSIVHKEIIVRDATRYHHFK 624 Query: 122 DGNCSCNDFW 93 DG CSCNDFW Sbjct: 625 DGRCSCNDFW 634 >ref|XP_004247893.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14050, mitochondrial-like [Solanum lycopersicum] Length = 610 Score = 127 bits (318), Expect = 2e-27 Identities = 53/70 (75%), Positives = 63/70 (90%) Frame = -1 Query: 302 WHSERLAVAYGLLKDVPGTVIQVVKNLRVCGDCHTVLKFICSIKKREIIVRDATRFHHFK 123 WHSERLAVAYG+L+ VPG+VI+VVKNLR+CGDCHTV+KFI SI R+I++RDA RFHHF Sbjct: 541 WHSERLAVAYGILRTVPGSVIRVVKNLRICGDCHTVIKFISSITSRKIVIRDANRFHHFN 600 Query: 122 DGNCSCNDFW 93 +G CSCNDFW Sbjct: 601 EGACSCNDFW 610 >ref|XP_003601696.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355490744|gb|AES71947.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 616 Score = 126 bits (316), Expect = 4e-27 Identities = 55/70 (78%), Positives = 60/70 (85%) Frame = -1 Query: 302 WHSERLAVAYGLLKDVPGTVIQVVKNLRVCGDCHTVLKFICSIKKREIIVRDATRFHHFK 123 WHSERLA+AYGLLK VPGT I++VKNLRVCGDCHTVLK I +I REI VRD R+HHFK Sbjct: 547 WHSERLALAYGLLKAVPGTTIRIVKNLRVCGDCHTVLKLISAITSREIYVRDVKRYHHFK 606 Query: 122 DGNCSCNDFW 93 DG CSCNDFW Sbjct: 607 DGKCSCNDFW 616 >gb|EYU31519.1| hypothetical protein MIMGU_mgv1a003519mg [Mimulus guttatus] Length = 580 Score = 125 bits (313), Expect = 8e-27 Identities = 54/70 (77%), Positives = 59/70 (84%) Frame = -1 Query: 302 WHSERLAVAYGLLKDVPGTVIQVVKNLRVCGDCHTVLKFICSIKKREIIVRDATRFHHFK 123 WHSERLAVAYGLLK G I+++KNLRVCGDCHTVLK +CSI REI+VRDA RFHHFK Sbjct: 511 WHSERLAVAYGLLKSARGAPIRIIKNLRVCGDCHTVLKLVCSIVGREIVVRDANRFHHFK 570 Query: 122 DGNCSCNDFW 93 DG CSC DFW Sbjct: 571 DGACSCRDFW 580 >ref|XP_006283355.1| hypothetical protein CARUB_v10004398mg [Capsella rubella] gi|482552060|gb|EOA16253.1| hypothetical protein CARUB_v10004398mg [Capsella rubella] Length = 612 Score = 125 bits (313), Expect = 8e-27 Identities = 56/70 (80%), Positives = 60/70 (85%) Frame = -1 Query: 302 WHSERLAVAYGLLKDVPGTVIQVVKNLRVCGDCHTVLKFICSIKKREIIVRDATRFHHFK 123 WHSER AVAYGLLK VPGT I++VKNLRVCGDCH VLK I I +REIIVRDATR+HHFK Sbjct: 543 WHSERSAVAYGLLKAVPGTPIRIVKNLRVCGDCHVVLKHISEITEREIIVRDATRYHHFK 602 Query: 122 DGNCSCNDFW 93 G CSCNDFW Sbjct: 603 GGKCSCNDFW 612 >ref|NP_193141.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|223635650|sp|O23266.3|PP308_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g14050, mitochondrial; Flags: Precursor gi|332657965|gb|AEE83365.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 612 Score = 125 bits (313), Expect = 8e-27 Identities = 56/70 (80%), Positives = 60/70 (85%) Frame = -1 Query: 302 WHSERLAVAYGLLKDVPGTVIQVVKNLRVCGDCHTVLKFICSIKKREIIVRDATRFHHFK 123 WHSER AVAYGLLK VPGT I++VKNLRVCGDCH VLK I I +REIIVRDATR+HHFK Sbjct: 543 WHSERSAVAYGLLKAVPGTPIRIVKNLRVCGDCHVVLKHISEITEREIIVRDATRYHHFK 602 Query: 122 DGNCSCNDFW 93 G CSCNDFW Sbjct: 603 GGKCSCNDFW 612