BLASTX nr result
ID: Paeonia25_contig00036134
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00036134 (247 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007397910.1| hypothetical protein PHACADRAFT_259421 [Phan... 68 1e-09 ref|XP_007306953.1| peptide transporter PTR2A [Stereum hirsutum ... 68 1e-09 ref|XP_007347902.1| proton-dependent oligopeptide transport fami... 67 3e-09 ref|XP_007363440.1| oligopeptide transporter [Dichomitus squalen... 62 6e-08 gb|EIW55673.1| oligopeptide transporter [Trametes versicolor FP-... 62 8e-08 gb|EIW55672.1| oligopeptide transporter [Trametes versicolor FP-... 62 8e-08 gb|ETW75136.1| H+/Oligopeptide symporter [Heterobasidion irregul... 60 3e-07 ref|XP_007363446.1| MFS peptide transporter [Dichomitus squalens... 60 3e-07 gb|EPQ51276.1| peptide transporter PTR2A [Gloeophyllum trabeum A... 59 7e-07 gb|EON98614.1| putative peptide transporter ptr2-a protein [Togn... 58 2e-06 ref|XP_007387975.1| PTR2-domain-containing protein [Punctularia ... 58 2e-06 gb|ELR05170.1| hypothetical protein GMDG_07211 [Pseudogymnoascus... 57 2e-06 gb|EMD36224.1| hypothetical protein CERSUDRAFT_84291 [Ceriporiop... 57 3e-06 gb|ERF72052.1| hypothetical protein EPUS_04970 [Endocarpon pusil... 56 6e-06 gb|EXJ82163.1| POT family proton-dependent oligopeptide transpor... 55 8e-06 gb|EXJ70420.1| POT family proton-dependent oligopeptide transpor... 55 8e-06 gb|EFQ29833.1| POT family protein [Colletotrichum graminicola M1... 55 8e-06 >ref|XP_007397910.1| hypothetical protein PHACADRAFT_259421 [Phanerochaete carnosa HHB-10118-sp] gi|409043735|gb|EKM53217.1| hypothetical protein PHACADRAFT_259421 [Phanerochaete carnosa HHB-10118-sp] Length = 605 Score = 67.8 bits (164), Expect = 1e-09 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = +1 Query: 1 NYGTMGVISFISGIIFWIQFRHLDKEEDELNAIQEGH 111 NYG MGV++FISGIIFW Q+RHLD++EDELN I EGH Sbjct: 560 NYGVMGVLAFISGIIFWFQYRHLDQQEDELNMIDEGH 596 >ref|XP_007306953.1| peptide transporter PTR2A [Stereum hirsutum FP-91666 SS1] gi|389742622|gb|EIM83808.1| peptide transporter PTR2A [Stereum hirsutum FP-91666 SS1] Length = 613 Score = 67.8 bits (164), Expect = 1e-09 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = +1 Query: 1 NYGTMGVISFISGIIFWIQFRHLDKEEDELNAIQEGHY 114 NYG M V++F+ GI FW+ FRHLDKEED LNA+QEGHY Sbjct: 557 NYGAMAVLAFVGGIAFWLSFRHLDKEEDALNALQEGHY 594 >ref|XP_007347902.1| proton-dependent oligopeptide transport family protein [Auricularia delicata TFB-10046 SS5] gi|393236324|gb|EJD43873.1| proton-dependent oligopeptide transport family protein [Auricularia delicata TFB-10046 SS5] Length = 613 Score = 67.0 bits (162), Expect = 3e-09 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = +1 Query: 1 NYGTMGVISFISGIIFWIQFRHLDKEEDELNAIQEGH 111 NYG+M VISFI+G+IFWIQFRHLD +EDELNA+ GH Sbjct: 568 NYGSMAVISFIAGVIFWIQFRHLDSQEDELNALSVGH 604 >ref|XP_007363440.1| oligopeptide transporter [Dichomitus squalens LYAD-421 SS1] gi|395331341|gb|EJF63722.1| oligopeptide transporter [Dichomitus squalens LYAD-421 SS1] Length = 597 Score = 62.4 bits (150), Expect = 6e-08 Identities = 24/38 (63%), Positives = 31/38 (81%) Frame = +1 Query: 1 NYGTMGVISFISGIIFWIQFRHLDKEEDELNAIQEGHY 114 NYG MGV++ ++G+IFW QFRHLD EDELN + +GHY Sbjct: 556 NYGAMGVLAAVAGVIFWFQFRHLDAAEDELNNLDDGHY 593 >gb|EIW55673.1| oligopeptide transporter [Trametes versicolor FP-101664 SS1] Length = 595 Score = 62.0 bits (149), Expect = 8e-08 Identities = 25/40 (62%), Positives = 32/40 (80%) Frame = +1 Query: 1 NYGTMGVISFISGIIFWIQFRHLDKEEDELNAIQEGHYVA 120 NYG MGV++FI+G IFW Q+R LD +ED+LN + EGHY A Sbjct: 555 NYGVMGVLAFIAGTIFWFQYRELDSQEDDLNDLSEGHYDA 594 >gb|EIW55672.1| oligopeptide transporter [Trametes versicolor FP-101664 SS1] Length = 592 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = +1 Query: 1 NYGTMGVISFISGIIFWIQFRHLDKEEDELNAIQEGHY 114 NYG MGV++FI+G IFW Q+R LD EDELN I EGHY Sbjct: 552 NYGVMGVLAFIAGTIFWFQYRELDAREDELNDITEGHY 589 >gb|ETW75136.1| H+/Oligopeptide symporter [Heterobasidion irregulare TC 32-1] Length = 608 Score = 60.1 bits (144), Expect = 3e-07 Identities = 24/37 (64%), Positives = 30/37 (81%) Frame = +1 Query: 1 NYGTMGVISFISGIIFWIQFRHLDKEEDELNAIQEGH 111 NYGTM V+S + G+ FW+ FRHLD+EE+ LN IQEGH Sbjct: 559 NYGTMAVLSGVGGVFFWLSFRHLDQEEEALNDIQEGH 595 >ref|XP_007363446.1| MFS peptide transporter [Dichomitus squalens LYAD-421 SS1] gi|395331347|gb|EJF63728.1| MFS peptide transporter [Dichomitus squalens LYAD-421 SS1] Length = 598 Score = 60.1 bits (144), Expect = 3e-07 Identities = 23/38 (60%), Positives = 31/38 (81%) Frame = +1 Query: 1 NYGTMGVISFISGIIFWIQFRHLDKEEDELNAIQEGHY 114 NYG+M V++ ++G+IFW QFRHLD EDELN ++E HY Sbjct: 557 NYGSMAVLAAVAGVIFWFQFRHLDAAEDELNHLEESHY 594 >gb|EPQ51276.1| peptide transporter PTR2A [Gloeophyllum trabeum ATCC 11539] Length = 612 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/37 (64%), Positives = 30/37 (81%) Frame = +1 Query: 1 NYGTMGVISFISGIIFWIQFRHLDKEEDELNAIQEGH 111 NYG M V++FI+G +FWI FRHLD++ED LN I EGH Sbjct: 565 NYGVMAVLAFIAGTLFWICFRHLDQQEDALNLISEGH 601 >gb|EON98614.1| putative peptide transporter ptr2-a protein [Togninia minima UCRPA7] Length = 602 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = +1 Query: 1 NYGTMGVISFISGIIFWIQFRHLDKEEDELNAIQEG 108 NYG M V++FI+G IFWIQFR LD EEDELN + EG Sbjct: 556 NYGAMAVLAFIAGCIFWIQFRSLDHEEDELNELPEG 591 >ref|XP_007387975.1| PTR2-domain-containing protein [Punctularia strigosozonata HHB-11173 SS5] gi|390595176|gb|EIN04582.1| PTR2-domain-containing protein [Punctularia strigosozonata HHB-11173 SS5] Length = 598 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/41 (58%), Positives = 29/41 (70%) Frame = +1 Query: 1 NYGTMGVISFISGIIFWIQFRHLDKEEDELNAIQEGHYVAH 123 NYG M V++ ++GI+FW RHLD EDELNAI EGH H Sbjct: 558 NYGVMAVLAGVAGIVFWFAHRHLDAAEDELNAIDEGHVEKH 598 >gb|ELR05170.1| hypothetical protein GMDG_07211 [Pseudogymnoascus destructans 20631-21] Length = 630 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/40 (62%), Positives = 29/40 (72%) Frame = +1 Query: 1 NYGTMGVISFISGIIFWIQFRHLDKEEDELNAIQEGHYVA 120 NYG M V+SF G +FW QFR LD +EDELN + EGH VA Sbjct: 566 NYGVMAVLSFFGGAMFWWQFRSLDAQEDELNMLPEGHAVA 605 >gb|EMD36224.1| hypothetical protein CERSUDRAFT_84291 [Ceriporiopsis subvermispora B] Length = 596 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/37 (62%), Positives = 29/37 (78%) Frame = +1 Query: 1 NYGTMGVISFISGIIFWIQFRHLDKEEDELNAIQEGH 111 NYG M V++ I+G IFW Q+R LD +EDELNA+ EGH Sbjct: 556 NYGVMAVLAVIAGTIFWFQYRELDAQEDELNALAEGH 592 >gb|ERF72052.1| hypothetical protein EPUS_04970 [Endocarpon pusillum Z07020] Length = 617 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/37 (62%), Positives = 29/37 (78%) Frame = +1 Query: 1 NYGTMGVISFISGIIFWIQFRHLDKEEDELNAIQEGH 111 NYG +GV+SFI G FW+QFR LDK+ED+LN + GH Sbjct: 558 NYGVVGVLSFIGGTGFWLQFRGLDKQEDQLNMLPTGH 594 >gb|EXJ82163.1| POT family proton-dependent oligopeptide transporter [Capronia coronata CBS 617.96] Length = 632 Score = 55.5 bits (132), Expect = 8e-06 Identities = 22/40 (55%), Positives = 31/40 (77%) Frame = +1 Query: 1 NYGTMGVISFISGIIFWIQFRHLDKEEDELNAIQEGHYVA 120 NYG V++F+ G++F++QF +LDKEEDELN + EGH A Sbjct: 571 NYGVFAVVAFVGGLLFFLQFLNLDKEEDELNLLPEGHVYA 610 >gb|EXJ70420.1| POT family proton-dependent oligopeptide transporter [Cladophialophora psammophila CBS 110553] Length = 617 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/50 (46%), Positives = 34/50 (68%) Frame = +1 Query: 1 NYGTMGVISFISGIIFWIQFRHLDKEEDELNAIQEGHYVAHVNTTAAAAG 150 NYG + V+S + GI+FW+ F+ LD EED+LN +Q YV N+ A+ +G Sbjct: 555 NYGVVAVLSGVGGILFWLNFKTLDSEEDKLNMLQVSSYVGKRNSIASVSG 604 >gb|EFQ29833.1| POT family protein [Colletotrichum graminicola M1.001] Length = 608 Score = 55.5 bits (132), Expect = 8e-06 Identities = 21/37 (56%), Positives = 31/37 (83%) Frame = +1 Query: 1 NYGTMGVISFISGIIFWIQFRHLDKEEDELNAIQEGH 111 NYG + V++ ++G+IFWIQFR LD++EDE+N + EGH Sbjct: 554 NYGIVAVLAAVAGVIFWIQFRGLDEDEDEMNELPEGH 590