BLASTX nr result
ID: Paeonia25_contig00036032
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00036032 (716 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB79632.1| hypothetical protein L484_011572 [Morus notabilis] 57 5e-06 >gb|EXB79632.1| hypothetical protein L484_011572 [Morus notabilis] Length = 418 Score = 57.4 bits (137), Expect = 5e-06 Identities = 24/48 (50%), Positives = 36/48 (75%) Frame = +2 Query: 2 LNRDTFAACLDFLKGKGDIEVAEEFIKLLKEQDHLEKNTCNKLVNYIH 145 LNR T A CL++LK +GD+E A E + LL+EQ+ L + C++LVN+I+ Sbjct: 339 LNRSTLAVCLEYLKREGDVETAHEILGLLREQNSLSNDICDRLVNFIN 386