BLASTX nr result
ID: Paeonia25_contig00035963
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00035963 (762 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPR57385.1| chloride transporter, chloride channel (ClC) fami... 59 1e-06 >gb|EPR57385.1| chloride transporter, chloride channel (ClC) family protein [Toxoplasma gondii GT1] Length = 2075 Score = 59.3 bits (142), Expect = 1e-06 Identities = 50/168 (29%), Positives = 73/168 (43%) Frame = -1 Query: 528 SPQYSSNASTMGNIHEAISPSASDPGNFTPAVRCPCNHCRPMVRSANLEDYTGPRSSPYE 349 SP SS++S + + SPS S P + +P P + P S P S+P Sbjct: 467 SPPSSSSSSPSSSPSTSTSPSPSSPPSSSPPSSSPSSSSPPPSSSPPPSSPPSPSSAPSS 526 Query: 348 SSFNVTTSPPRSTGRNRPFELVEDYGTQSVSLLPPPAHEIPSGSGQGPTHASQSFHANQH 169 S+ +SPP S+ + P + S S PP + S + P+ A S + Sbjct: 527 STSPSPSSPPSSSPPS-PSSAPSSSTSPSPSSPPPSSPPSSSSTSPSPSSAPSSSPPSPS 585 Query: 168 SPETAPPLQTVMGYSAGSNHILMSHSPSQAPTHSSPLSTAISSAPPSS 25 P ++PP S+ S S SPS AP+ S P S+ SS+PP S Sbjct: 586 PPPSSPP-------SSSST----SPSPSSAPSSSPPSSSPSSSSPPPS 622