BLASTX nr result
ID: Paeonia25_contig00035732
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00035732 (252 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADB02902.1| mitochondrial import inner membrane translocase s... 90 4e-16 ref|XP_002284270.1| PREDICTED: mitochondrial import inner membra... 90 4e-16 ref|XP_002511123.1| translocase of inner mitochondrial membrane,... 89 6e-16 ref|XP_002322283.1| hypothetical protein POPTR_0015s11410g [Popu... 87 2e-15 ref|XP_006493255.1| PREDICTED: mitochondrial import inner membra... 87 2e-15 ref|XP_006436903.1| hypothetical protein CICLE_v100332302mg, par... 87 2e-15 gb|ACU15787.1| unknown [Glycine max] 87 3e-15 ref|XP_007038081.1| Translocase inner membrane subunit 8 [Theobr... 86 4e-15 ref|XP_006281366.1| hypothetical protein CARUB_v10027424mg, part... 86 4e-15 ref|XP_002865825.1| hypothetical protein ARALYDRAFT_495143 [Arab... 86 5e-15 ref|XP_004138031.1| PREDICTED: mitochondrial import inner membra... 86 7e-15 ref|XP_004501728.1| PREDICTED: mitochondrial import inner membra... 85 9e-15 gb|ADW66158.1| mitochondrial import inner membrane translocase s... 85 9e-15 ref|XP_004241454.1| PREDICTED: mitochondrial import inner membra... 85 1e-14 ref|NP_199894.1| translocase inner membrane subunit 8 [Arabidops... 85 1e-14 ref|XP_003574839.1| PREDICTED: mitochondrial import inner membra... 84 2e-14 gb|EXB54900.1| Mitochondrial import inner membrane translocase s... 84 2e-14 ref|XP_006347349.1| PREDICTED: mitochondrial import inner membra... 83 3e-14 gb|EYU43024.1| hypothetical protein MIMGU_mgv1a017418mg [Mimulus... 83 4e-14 gb|ABK27025.1| unknown [Picea sitchensis] gi|148910560|gb|ABR183... 83 4e-14 >gb|ADB02902.1| mitochondrial import inner membrane translocase subunit Tim8/small zinc finger-like protein [Jatropha curcas] Length = 78 Score = 89.7 bits (221), Expect = 4e-16 Identities = 39/46 (84%), Positives = 43/46 (93%) Frame = -3 Query: 250 VTKQCWDKCITSTPGSKFSSSESTCLTNCAQRYMDMSAVIMKRFQS 113 +T +CWDKCITSTPGSKFSSSES CL+NCAQRYMDMS +IMKRFQS Sbjct: 31 LTSECWDKCITSTPGSKFSSSESACLSNCAQRYMDMSLIIMKRFQS 76 >ref|XP_002284270.1| PREDICTED: mitochondrial import inner membrane translocase subunit Tim8 [Vitis vinifera] gi|297734470|emb|CBI15717.3| unnamed protein product [Vitis vinifera] Length = 77 Score = 89.7 bits (221), Expect = 4e-16 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = -3 Query: 250 VTKQCWDKCITSTPGSKFSSSESTCLTNCAQRYMDMSAVIMKRFQS 113 +T CWDKCITSTPGSKFSSSESTCL+NCAQRYMDMS +IMKRFQS Sbjct: 30 LTTVCWDKCITSTPGSKFSSSESTCLSNCAQRYMDMSLIIMKRFQS 75 >ref|XP_002511123.1| translocase of inner mitochondrial membrane, putative [Ricinus communis] gi|223550238|gb|EEF51725.1| translocase of inner mitochondrial membrane, putative [Ricinus communis] Length = 78 Score = 89.0 bits (219), Expect = 6e-16 Identities = 39/46 (84%), Positives = 42/46 (91%) Frame = -3 Query: 250 VTKQCWDKCITSTPGSKFSSSESTCLTNCAQRYMDMSAVIMKRFQS 113 +T CWDKCITSTPGSKFSSSES+CLTNC QRYMDMS +IMKRFQS Sbjct: 31 LTSACWDKCITSTPGSKFSSSESSCLTNCTQRYMDMSLIIMKRFQS 76 >ref|XP_002322283.1| hypothetical protein POPTR_0015s11410g [Populus trichocarpa] gi|118483366|gb|ABK93584.1| unknown [Populus trichocarpa] gi|222869279|gb|EEF06410.1| hypothetical protein POPTR_0015s11410g [Populus trichocarpa] Length = 78 Score = 87.4 bits (215), Expect = 2e-15 Identities = 38/46 (82%), Positives = 43/46 (93%) Frame = -3 Query: 250 VTKQCWDKCITSTPGSKFSSSESTCLTNCAQRYMDMSAVIMKRFQS 113 +T CWDKCITS+PGSKFSSSES+CL+NCAQRYMDMS +IMKRFQS Sbjct: 31 LTSACWDKCITSSPGSKFSSSESSCLSNCAQRYMDMSLIIMKRFQS 76 >ref|XP_006493255.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM8-like [Citrus sinensis] Length = 78 Score = 87.0 bits (214), Expect = 2e-15 Identities = 38/46 (82%), Positives = 41/46 (89%) Frame = -3 Query: 250 VTKQCWDKCITSTPGSKFSSSESTCLTNCAQRYMDMSAVIMKRFQS 113 +T CWDKCITSTPGSKFSSSES CL NCAQRY+DMS +IMKRFQS Sbjct: 31 LTNVCWDKCITSTPGSKFSSSESACLANCAQRYLDMSVIIMKRFQS 76 >ref|XP_006436903.1| hypothetical protein CICLE_v100332302mg, partial [Citrus clementina] gi|557539099|gb|ESR50143.1| hypothetical protein CICLE_v100332302mg, partial [Citrus clementina] Length = 62 Score = 87.0 bits (214), Expect = 2e-15 Identities = 38/46 (82%), Positives = 41/46 (89%) Frame = -3 Query: 250 VTKQCWDKCITSTPGSKFSSSESTCLTNCAQRYMDMSAVIMKRFQS 113 +T CWDKCITSTPGSKFSSSES CL NCAQRY+DMS +IMKRFQS Sbjct: 15 LTNVCWDKCITSTPGSKFSSSESACLANCAQRYLDMSVIIMKRFQS 60 >gb|ACU15787.1| unknown [Glycine max] Length = 78 Score = 86.7 bits (213), Expect = 3e-15 Identities = 38/46 (82%), Positives = 42/46 (91%) Frame = -3 Query: 250 VTKQCWDKCITSTPGSKFSSSESTCLTNCAQRYMDMSAVIMKRFQS 113 +T CWDKCI STPGSKFSSSE+TCLTNC+QRYMDMS +IMKRFQS Sbjct: 31 LTHICWDKCIASTPGSKFSSSETTCLTNCSQRYMDMSMIIMKRFQS 76 >ref|XP_007038081.1| Translocase inner membrane subunit 8 [Theobroma cacao] gi|508775326|gb|EOY22582.1| Translocase inner membrane subunit 8 [Theobroma cacao] Length = 185 Score = 86.3 bits (212), Expect = 4e-15 Identities = 38/46 (82%), Positives = 42/46 (91%) Frame = -3 Query: 250 VTKQCWDKCITSTPGSKFSSSESTCLTNCAQRYMDMSAVIMKRFQS 113 +T CWDKCITSTPGSKFSSSES CL++CAQRYMDMS +IMKRFQS Sbjct: 138 LTSVCWDKCITSTPGSKFSSSESACLSHCAQRYMDMSLIIMKRFQS 183 >ref|XP_006281366.1| hypothetical protein CARUB_v10027424mg, partial [Capsella rubella] gi|482550070|gb|EOA14264.1| hypothetical protein CARUB_v10027424mg, partial [Capsella rubella] Length = 103 Score = 86.3 bits (212), Expect = 4e-15 Identities = 37/47 (78%), Positives = 43/47 (91%) Frame = -3 Query: 250 VTKQCWDKCITSTPGSKFSSSESTCLTNCAQRYMDMSAVIMKRFQSR 110 +T CWDKC+TS PGSKFSSSESTCL++CAQRYMDMS +IMKRFQS+ Sbjct: 57 LTSVCWDKCVTSAPGSKFSSSESTCLSHCAQRYMDMSMIIMKRFQSQ 103 >ref|XP_002865825.1| hypothetical protein ARALYDRAFT_495143 [Arabidopsis lyrata subsp. lyrata] gi|297311660|gb|EFH42084.1| hypothetical protein ARALYDRAFT_495143 [Arabidopsis lyrata subsp. lyrata] Length = 77 Score = 85.9 bits (211), Expect = 5e-15 Identities = 37/47 (78%), Positives = 43/47 (91%) Frame = -3 Query: 250 VTKQCWDKCITSTPGSKFSSSESTCLTNCAQRYMDMSAVIMKRFQSR 110 +T CWDKCITS PGSKFSSSES+CLT+CAQRYMDMS ++MKRFQS+ Sbjct: 31 MTSVCWDKCITSAPGSKFSSSESSCLTHCAQRYMDMSMILMKRFQSQ 77 >ref|XP_004138031.1| PREDICTED: mitochondrial import inner membrane translocase subunit Tim8-like [Cucumis sativus] gi|449532151|ref|XP_004173046.1| PREDICTED: mitochondrial import inner membrane translocase subunit Tim8-like [Cucumis sativus] Length = 77 Score = 85.5 bits (210), Expect = 7e-15 Identities = 37/46 (80%), Positives = 41/46 (89%) Frame = -3 Query: 250 VTKQCWDKCITSTPGSKFSSSESTCLTNCAQRYMDMSAVIMKRFQS 113 +T CWDKCIT TPGSKFSSSES CL+NCAQRYMDMS +IMKRFQ+ Sbjct: 31 LTSVCWDKCITGTPGSKFSSSESNCLSNCAQRYMDMSIIIMKRFQN 76 >ref|XP_004501728.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM8-like [Cicer arietinum] Length = 78 Score = 85.1 bits (209), Expect = 9e-15 Identities = 36/46 (78%), Positives = 42/46 (91%) Frame = -3 Query: 250 VTKQCWDKCITSTPGSKFSSSESTCLTNCAQRYMDMSAVIMKRFQS 113 +T +CWDKCIT TPG+KFSSSE+ CLTNCAQRYM+MS +IMKRFQS Sbjct: 31 LTSECWDKCITGTPGNKFSSSETNCLTNCAQRYMEMSMLIMKRFQS 76 >gb|ADW66158.1| mitochondrial import inner membrane translocase subunit [Solanum nigrum] Length = 78 Score = 85.1 bits (209), Expect = 9e-15 Identities = 36/46 (78%), Positives = 42/46 (91%) Frame = -3 Query: 250 VTKQCWDKCITSTPGSKFSSSESTCLTNCAQRYMDMSAVIMKRFQS 113 +T CWDKCIT TPGSKFSSSES+CLTNCAQRYM+MS +I+KRFQ+ Sbjct: 31 LTSSCWDKCITGTPGSKFSSSESSCLTNCAQRYMEMSLIIVKRFQN 76 >ref|XP_004241454.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM8-like [Solanum lycopersicum] Length = 78 Score = 84.7 bits (208), Expect = 1e-14 Identities = 37/46 (80%), Positives = 42/46 (91%) Frame = -3 Query: 250 VTKQCWDKCITSTPGSKFSSSESTCLTNCAQRYMDMSAVIMKRFQS 113 +T CWDKCITSTPGSKFSSSES CL+NCAQRYM+MS +I+KRFQS Sbjct: 31 LTSACWDKCITSTPGSKFSSSESNCLSNCAQRYMEMSLMIVKRFQS 76 >ref|NP_199894.1| translocase inner membrane subunit 8 [Arabidopsis thaliana] gi|12230183|sp|Q9XGY4.1|TIM8_ARATH RecName: Full=Mitochondrial import inner membrane translocase subunit TIM8 gi|5107155|gb|AAD39990.1|AF150083_1 small zinc finger-like protein [Arabidopsis thaliana] gi|9758528|dbj|BAB08904.1| small zinc finger-like protein [Arabidopsis thaliana] gi|21592903|gb|AAM64853.1| small zinc finger-like protein [Arabidopsis thaliana] gi|27754501|gb|AAO22698.1| putative small zinc finger protein [Arabidopsis thaliana] gi|28393983|gb|AAO42399.1| putative small zinc finger protein [Arabidopsis thaliana] gi|332008612|gb|AED95995.1| translocase inner membrane subunit 8 [Arabidopsis thaliana] Length = 77 Score = 84.7 bits (208), Expect = 1e-14 Identities = 37/47 (78%), Positives = 42/47 (89%) Frame = -3 Query: 250 VTKQCWDKCITSTPGSKFSSSESTCLTNCAQRYMDMSAVIMKRFQSR 110 +T CWDKCITS PGSKFSSSES+CLT+CAQRYMDMS +IMKRF S+ Sbjct: 31 MTSVCWDKCITSAPGSKFSSSESSCLTHCAQRYMDMSMIIMKRFNSQ 77 >ref|XP_003574839.1| PREDICTED: mitochondrial import inner membrane translocase subunit Tim8-like [Brachypodium distachyon] Length = 72 Score = 84.3 bits (207), Expect = 2e-14 Identities = 36/45 (80%), Positives = 40/45 (88%) Frame = -3 Query: 250 VTKQCWDKCITSTPGSKFSSSESTCLTNCAQRYMDMSAVIMKRFQ 116 +T CWDKCITSTPGSKFSS E+TCLTNCAQRY+DMS +I KRFQ Sbjct: 26 LTNVCWDKCITSTPGSKFSSGETTCLTNCAQRYLDMSVIIAKRFQ 70 >gb|EXB54900.1| Mitochondrial import inner membrane translocase subunit Tim8 [Morus notabilis] Length = 78 Score = 84.0 bits (206), Expect = 2e-14 Identities = 36/46 (78%), Positives = 43/46 (93%) Frame = -3 Query: 250 VTKQCWDKCITSTPGSKFSSSESTCLTNCAQRYMDMSAVIMKRFQS 113 +T CWDKCITSTPGSKFSSSE +CL+NCA+RY+DMSA+IMKRFQ+ Sbjct: 31 LTTVCWDKCITSTPGSKFSSSEQSCLSNCARRYLDMSALIMKRFQN 76 >ref|XP_006347349.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM8-like [Solanum tuberosum] Length = 78 Score = 83.2 bits (204), Expect = 3e-14 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = -3 Query: 250 VTKQCWDKCITSTPGSKFSSSESTCLTNCAQRYMDMSAVIMKRFQS 113 +T CWDKCIT TPGSKFSSSES CL+NCAQRYM+MS +I+KRFQS Sbjct: 31 LTSACWDKCITGTPGSKFSSSESNCLSNCAQRYMEMSLMIVKRFQS 76 >gb|EYU43024.1| hypothetical protein MIMGU_mgv1a017418mg [Mimulus guttatus] Length = 76 Score = 82.8 bits (203), Expect = 4e-14 Identities = 36/45 (80%), Positives = 39/45 (86%) Frame = -3 Query: 250 VTKQCWDKCITSTPGSKFSSSESTCLTNCAQRYMDMSAVIMKRFQ 116 +T CWDKCIT TPGSKFSS E+TCLTNCAQRYMDMS +IMKR Q Sbjct: 31 LTAACWDKCITGTPGSKFSSGETTCLTNCAQRYMDMSLLIMKRLQ 75 >gb|ABK27025.1| unknown [Picea sitchensis] gi|148910560|gb|ABR18352.1| unknown [Picea sitchensis] Length = 77 Score = 82.8 bits (203), Expect = 4e-14 Identities = 35/46 (76%), Positives = 42/46 (91%) Frame = -3 Query: 250 VTKQCWDKCITSTPGSKFSSSESTCLTNCAQRYMDMSAVIMKRFQS 113 +T CWDKCITS PGSKFSSSE+ CLTNCAQR++DMSA+I++RFQS Sbjct: 30 LTDVCWDKCITSAPGSKFSSSETACLTNCAQRFLDMSAIIIRRFQS 75