BLASTX nr result
ID: Paeonia25_contig00031975
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00031975 (325 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCL99996.1| predicted protein [Fibroporia radiculosa] 56 6e-06 >emb|CCL99996.1| predicted protein [Fibroporia radiculosa] Length = 1183 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/73 (39%), Positives = 41/73 (56%) Frame = -3 Query: 260 VAKKGQLFNVAGIVTEDPRTLTTSTGEFKRRLMITDSSYREIDSRGFNINCFRKFEDELP 81 V KG+ +NV G+V TT T E+K RL + D S GF++NCF K +D LP Sbjct: 522 VQSKGKSYNVMGVVQSTGSIETTRTNEWKIRLHLVDPGVHV--SGGFSVNCFGKTKDSLP 579 Query: 80 GPKEGQVIILRNL 42 P G ++++R L Sbjct: 580 TPCPGNILVIRQL 592