BLASTX nr result
ID: Paeonia25_contig00031682
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00031682 (293 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006410309.1| hypothetical protein EUTSA_v10016569mg [Eutr... 70 2e-10 ref|XP_006294093.1| hypothetical protein CARUB_v10023086mg [Caps... 70 2e-10 ref|XP_002879344.1| hypothetical protein ARALYDRAFT_482103 [Arab... 70 2e-10 ref|NP_850173.2| ACT domain-containing small subunit of acetolac... 70 2e-10 ref|NP_850172.1| ACT domain-containing small subunit of acetolac... 70 2e-10 gb|AAD32291.1| putative acetolactate synthase [Arabidopsis thali... 70 2e-10 ref|XP_007201965.1| hypothetical protein PRUPE_ppa004716mg [Prun... 70 3e-10 ref|XP_006470698.1| PREDICTED: acetolactate synthase small subun... 68 1e-09 ref|XP_006446199.1| hypothetical protein CICLE_v10015044mg [Citr... 68 1e-09 ref|XP_006446198.1| hypothetical protein CICLE_v10015044mg [Citr... 68 1e-09 ref|XP_007033634.1| ACT domain-containing small subunit of aceto... 68 1e-09 ref|XP_007033633.1| Poly(A) polymerase 1 [Theobroma cacao] gi|50... 68 1e-09 ref|XP_004159602.1| PREDICTED: uncharacterized LOC101212902 [Cuc... 68 1e-09 ref|XP_004149627.1| PREDICTED: uncharacterized protein LOC101212... 68 1e-09 dbj|BAD19594.1| putative acetolactate synthase small subunit [Or... 68 1e-09 ref|NP_001047389.2| Os02g0608600 [Oryza sativa Japonica Group] g... 68 1e-09 gb|EEE57346.1| hypothetical protein OsJ_07472 [Oryza sativa Japo... 68 1e-09 ref|XP_002310395.2| hypothetical protein POPTR_0007s00700g [Popu... 68 2e-09 gb|AFK41430.1| unknown [Lotus japonicus] 68 2e-09 ref|XP_002529819.1| acetolactate synthase, putative [Ricinus com... 68 2e-09 >ref|XP_006410309.1| hypothetical protein EUTSA_v10016569mg [Eutrema salsugineum] gi|557111478|gb|ESQ51762.1| hypothetical protein EUTSA_v10016569mg [Eutrema salsugineum] Length = 491 Score = 70.5 bits (171), Expect = 2e-10 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = +3 Query: 3 LEPYGICEVARTGRVALARESGVDSKHLRGYAFPF*G 113 LEPYGICEVARTGRVALARESGVDSK+LRGY+FP G Sbjct: 455 LEPYGICEVARTGRVALARESGVDSKYLRGYSFPLTG 491 >ref|XP_006294093.1| hypothetical protein CARUB_v10023086mg [Capsella rubella] gi|482562801|gb|EOA26991.1| hypothetical protein CARUB_v10023086mg [Capsella rubella] Length = 492 Score = 70.5 bits (171), Expect = 2e-10 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = +3 Query: 3 LEPYGICEVARTGRVALARESGVDSKHLRGYAFPF*G 113 LEPYGICEVARTGRVALARESGVDSK+LRGY+FP G Sbjct: 456 LEPYGICEVARTGRVALARESGVDSKYLRGYSFPLTG 492 >ref|XP_002879344.1| hypothetical protein ARALYDRAFT_482103 [Arabidopsis lyrata subsp. lyrata] gi|297325183|gb|EFH55603.1| hypothetical protein ARALYDRAFT_482103 [Arabidopsis lyrata subsp. lyrata] Length = 492 Score = 70.5 bits (171), Expect = 2e-10 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = +3 Query: 3 LEPYGICEVARTGRVALARESGVDSKHLRGYAFPF*G 113 LEPYGICEVARTGRVALARESGVDSK+LRGY+FP G Sbjct: 456 LEPYGICEVARTGRVALARESGVDSKYLRGYSFPLSG 492 >ref|NP_850173.2| ACT domain-containing small subunit of acetolactate synthase protein [Arabidopsis thaliana] gi|330253493|gb|AEC08587.1| ACT domain-containing small subunit of acetolactate synthase protein [Arabidopsis thaliana] Length = 421 Score = 70.5 bits (171), Expect = 2e-10 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = +3 Query: 3 LEPYGICEVARTGRVALARESGVDSKHLRGYAFPF*G 113 LEPYGICEVARTGRVALARESGVDSK+LRGY+FP G Sbjct: 385 LEPYGICEVARTGRVALARESGVDSKYLRGYSFPLTG 421 >ref|NP_850172.1| ACT domain-containing small subunit of acetolactate synthase protein [Arabidopsis thaliana] gi|75249445|sp|Q93YZ7.1|ILVH2_ARATH RecName: Full=Acetolactate synthase small subunit 2, chloroplastic; AltName: Full=Acetohydroxy-acid synthase small subunit; Short=AHAS; Short=ALS; Flags: Precursor gi|16604523|gb|AAL24267.1| At2g31810/F20M17.15 [Arabidopsis thaliana] gi|21655295|gb|AAM65359.1| At2g31810/F20M17.15 [Arabidopsis thaliana] gi|330253492|gb|AEC08586.1| ACT domain-containing small subunit of acetolactate synthase protein [Arabidopsis thaliana] Length = 491 Score = 70.5 bits (171), Expect = 2e-10 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = +3 Query: 3 LEPYGICEVARTGRVALARESGVDSKHLRGYAFPF*G 113 LEPYGICEVARTGRVALARESGVDSK+LRGY+FP G Sbjct: 455 LEPYGICEVARTGRVALARESGVDSKYLRGYSFPLTG 491 >gb|AAD32291.1| putative acetolactate synthase [Arabidopsis thaliana] Length = 484 Score = 70.5 bits (171), Expect = 2e-10 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = +3 Query: 3 LEPYGICEVARTGRVALARESGVDSKHLRGYAFPF*G 113 LEPYGICEVARTGRVALARESGVDSK+LRGY+FP G Sbjct: 448 LEPYGICEVARTGRVALARESGVDSKYLRGYSFPLTG 484 >ref|XP_007201965.1| hypothetical protein PRUPE_ppa004716mg [Prunus persica] gi|462397496|gb|EMJ03164.1| hypothetical protein PRUPE_ppa004716mg [Prunus persica] Length = 494 Score = 70.1 bits (170), Expect = 3e-10 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +3 Query: 3 LEPYGICEVARTGRVALARESGVDSKHLRGYAFP 104 LEPYGICEVARTGR+AL RESGVDSKHLRGY+FP Sbjct: 460 LEPYGICEVARTGRIALVRESGVDSKHLRGYSFP 493 >ref|XP_006470698.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like [Citrus sinensis] Length = 488 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +3 Query: 3 LEPYGICEVARTGRVALARESGVDSKHLRGYAFP 104 LEPYGICEVARTGRVAL RESGVDSK+LRGY+FP Sbjct: 454 LEPYGICEVARTGRVALVRESGVDSKYLRGYSFP 487 >ref|XP_006446199.1| hypothetical protein CICLE_v10015044mg [Citrus clementina] gi|557548810|gb|ESR59439.1| hypothetical protein CICLE_v10015044mg [Citrus clementina] Length = 488 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +3 Query: 3 LEPYGICEVARTGRVALARESGVDSKHLRGYAFP 104 LEPYGICEVARTGRVAL RESGVDSK+LRGY+FP Sbjct: 454 LEPYGICEVARTGRVALVRESGVDSKYLRGYSFP 487 >ref|XP_006446198.1| hypothetical protein CICLE_v10015044mg [Citrus clementina] gi|557548809|gb|ESR59438.1| hypothetical protein CICLE_v10015044mg [Citrus clementina] Length = 471 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +3 Query: 3 LEPYGICEVARTGRVALARESGVDSKHLRGYAFP 104 LEPYGICEVARTGRVAL RESGVDSK+LRGY+FP Sbjct: 437 LEPYGICEVARTGRVALVRESGVDSKYLRGYSFP 470 >ref|XP_007033634.1| ACT domain-containing small subunit of acetolactate synthase protein [Theobroma cacao] gi|508712663|gb|EOY04560.1| ACT domain-containing small subunit of acetolactate synthase protein [Theobroma cacao] Length = 478 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +3 Query: 3 LEPYGICEVARTGRVALARESGVDSKHLRGYAFP 104 LEPYGICEVARTGRVAL RESGVDSK+LRGY+FP Sbjct: 444 LEPYGICEVARTGRVALVRESGVDSKYLRGYSFP 477 >ref|XP_007033633.1| Poly(A) polymerase 1 [Theobroma cacao] gi|508712662|gb|EOY04559.1| Poly(A) polymerase 1 [Theobroma cacao] Length = 788 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +3 Query: 3 LEPYGICEVARTGRVALARESGVDSKHLRGYAFP 104 LEPYGICEVARTGRVAL RESGVDSK+LRGY+FP Sbjct: 754 LEPYGICEVARTGRVALVRESGVDSKYLRGYSFP 787 >ref|XP_004159602.1| PREDICTED: uncharacterized LOC101212902 [Cucumis sativus] Length = 412 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +3 Query: 3 LEPYGICEVARTGRVALARESGVDSKHLRGYAFP 104 LEPYGICEVARTGRVAL RESGVDSK+LRGY+FP Sbjct: 378 LEPYGICEVARTGRVALVRESGVDSKYLRGYSFP 411 >ref|XP_004149627.1| PREDICTED: uncharacterized protein LOC101212902 [Cucumis sativus] Length = 489 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +3 Query: 3 LEPYGICEVARTGRVALARESGVDSKHLRGYAFP 104 LEPYGICEVARTGRVAL RESGVDSK+LRGY+FP Sbjct: 455 LEPYGICEVARTGRVALVRESGVDSKYLRGYSFP 488 >dbj|BAD19594.1| putative acetolactate synthase small subunit [Oryza sativa Japonica Group] gi|47497949|dbj|BAD20154.1| putative acetolactate synthase small subunit [Oryza sativa Japonica Group] Length = 323 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +3 Query: 3 LEPYGICEVARTGRVALARESGVDSKHLRGYAFP 104 LEPYGICEVARTGRVAL RESGVDSK+LRGY+FP Sbjct: 289 LEPYGICEVARTGRVALVRESGVDSKYLRGYSFP 322 >ref|NP_001047389.2| Os02g0608600 [Oryza sativa Japonica Group] gi|255671076|dbj|BAF09303.2| Os02g0608600, partial [Oryza sativa Japonica Group] Length = 340 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +3 Query: 3 LEPYGICEVARTGRVALARESGVDSKHLRGYAFP 104 LEPYGICEVARTGRVAL RESGVDSK+LRGY+FP Sbjct: 306 LEPYGICEVARTGRVALVRESGVDSKYLRGYSFP 339 >gb|EEE57346.1| hypothetical protein OsJ_07472 [Oryza sativa Japonica Group] Length = 422 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +3 Query: 3 LEPYGICEVARTGRVALARESGVDSKHLRGYAFP 104 LEPYGICEVARTGRVAL RESGVDSK+LRGY+FP Sbjct: 388 LEPYGICEVARTGRVALVRESGVDSKYLRGYSFP 421 >ref|XP_002310395.2| hypothetical protein POPTR_0007s00700g [Populus trichocarpa] gi|550333837|gb|EEE90845.2| hypothetical protein POPTR_0007s00700g [Populus trichocarpa] Length = 490 Score = 67.8 bits (164), Expect = 2e-09 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = +3 Query: 3 LEPYGICEVARTGRVALARESGVDSKHLRGYAFP 104 LEPYGICEVARTGR+AL RESGVDSK+LRGY+FP Sbjct: 456 LEPYGICEVARTGRIALTRESGVDSKYLRGYSFP 489 >gb|AFK41430.1| unknown [Lotus japonicus] Length = 478 Score = 67.8 bits (164), Expect = 2e-09 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = +3 Query: 3 LEPYGICEVARTGRVALARESGVDSKHLRGYAFP 104 LEPYGICEVARTGR+AL RESGVDSK+LRGY+FP Sbjct: 444 LEPYGICEVARTGRIALVRESGVDSKYLRGYSFP 477 >ref|XP_002529819.1| acetolactate synthase, putative [Ricinus communis] gi|223530696|gb|EEF32568.1| acetolactate synthase, putative [Ricinus communis] Length = 493 Score = 67.8 bits (164), Expect = 2e-09 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = +3 Query: 3 LEPYGICEVARTGRVALARESGVDSKHLRGYAFP 104 LEPYGICEVARTGR+AL RESGVDSK+LRGY+FP Sbjct: 459 LEPYGICEVARTGRIALVRESGVDSKYLRGYSFP 492