BLASTX nr result
ID: Paeonia25_contig00030844
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00030844 (538 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCM04237.1| predicted protein [Fibroporia radiculosa] 66 5e-09 >emb|CCM04237.1| predicted protein [Fibroporia radiculosa] Length = 744 Score = 66.2 bits (160), Expect = 5e-09 Identities = 37/78 (47%), Positives = 45/78 (57%), Gaps = 5/78 (6%) Frame = -2 Query: 324 PSRPAS-----PAAGQHPATHPVNRYPAYDASRRRIGLEHLRYPSTPHPRGDGTSYYRPR 160 P PA P + P RYPAYDA+ RRIG+EH+RY P G G SYYR R Sbjct: 187 PQMPAEDTFNVPEPIEQPPLFNPERYPAYDANARRIGMEHVRYGEVP-SEGTGQSYYRSR 245 Query: 159 TQQYPVHNQGPRVMNIAL 106 TQ YP+ GP+VM++ L Sbjct: 246 TQTYPM---GPQVMSMTL 260