BLASTX nr result
ID: Paeonia25_contig00030739
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00030739 (244 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002301628.2| hypothetical protein POPTR_0002s23070g [Popu... 57 2e-06 >ref|XP_002301628.2| hypothetical protein POPTR_0002s23070g [Populus trichocarpa] gi|550345647|gb|EEE80901.2| hypothetical protein POPTR_0002s23070g [Populus trichocarpa] Length = 87 Score = 57.4 bits (137), Expect = 2e-06 Identities = 32/64 (50%), Positives = 43/64 (67%), Gaps = 4/64 (6%) Frame = -3 Query: 242 GFDKS----QVIEKFPKMKHQIEEDMQPQVLLYKKLWLEAEAEMLSVKYKDSLVRMKRR* 75 GF+K+ QV EK + +++EE+ PQVLLYK LWLEAEA + S+KYK S++ MK Sbjct: 20 GFNKNEHITQVNEKALEGHYELEEEENPQVLLYKNLWLEAEAALCSMKYKASVLGMKTEM 79 Query: 74 IKSK 63 K K Sbjct: 80 AKIK 83