BLASTX nr result
ID: Paeonia25_contig00030736
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00030736 (444 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006479944.1| PREDICTED: beta-glucosidase 11-like [Citrus ... 86 7e-15 ref|XP_006444313.1| hypothetical protein CICLE_v10019788mg [Citr... 86 7e-15 ref|XP_007050907.1| Beta glucosidase 11, putative [Theobroma cac... 85 9e-15 ref|XP_006486817.1| PREDICTED: beta-glucosidase 11-like isoform ... 82 1e-13 ref|XP_006486815.1| PREDICTED: beta-glucosidase 11-like isoform ... 82 1e-13 ref|XP_006486813.1| PREDICTED: beta-glucosidase 11-like isoform ... 82 1e-13 ref|XP_002267595.2| PREDICTED: beta-glucosidase 11-like [Vitis v... 82 1e-13 emb|CBI36856.3| unnamed protein product [Vitis vinifera] 82 1e-13 emb|CBI36854.3| unnamed protein product [Vitis vinifera] 82 1e-13 ref|XP_002268147.1| PREDICTED: beta-glucosidase 11-like isoform ... 82 1e-13 ref|XP_006422698.1| hypothetical protein CICLE_v10029910mg [Citr... 81 2e-13 emb|CAN82274.1| hypothetical protein VITISV_040383 [Vitis vinifera] 80 4e-13 ref|XP_007050911.1| Beta glucosidase 11 [Theobroma cacao] gi|508... 78 1e-12 ref|XP_003632372.1| PREDICTED: beta-glucosidase 11-like [Vitis v... 76 6e-12 emb|CBI36851.3| unnamed protein product [Vitis vinifera] 76 6e-12 emb|CAN81257.1| hypothetical protein VITISV_000964 [Vitis vinifera] 76 6e-12 ref|XP_002523071.1| beta-glucosidase, putative [Ricinus communis... 75 9e-12 ref|XP_006422708.1| hypothetical protein CICLE_v10028386mg [Citr... 74 2e-11 ref|XP_007050908.1| Beta glucosidase 11 isoform 1 [Theobroma cac... 74 2e-11 ref|XP_002267643.2| PREDICTED: beta-glucosidase 11-like [Vitis v... 74 2e-11 >ref|XP_006479944.1| PREDICTED: beta-glucosidase 11-like [Citrus sinensis] Length = 508 Score = 85.5 bits (210), Expect = 7e-15 Identities = 37/55 (67%), Positives = 45/55 (81%) Frame = -1 Query: 444 FGLYYVDREDPDLKRYPKLSAHWYSDFLKRRSISSDGVIEVDKNFSALAHAHSFQ 280 +GLYYVDR+DPDLKRYPKLSAHWYS FLK RS+SSD ++KNFS ++ H +Q Sbjct: 454 YGLYYVDRDDPDLKRYPKLSAHWYSQFLKGRSLSSDEDFALEKNFSGPSYGHDYQ 508 >ref|XP_006444313.1| hypothetical protein CICLE_v10019788mg [Citrus clementina] gi|557546575|gb|ESR57553.1| hypothetical protein CICLE_v10019788mg [Citrus clementina] Length = 508 Score = 85.5 bits (210), Expect = 7e-15 Identities = 37/55 (67%), Positives = 45/55 (81%) Frame = -1 Query: 444 FGLYYVDREDPDLKRYPKLSAHWYSDFLKRRSISSDGVIEVDKNFSALAHAHSFQ 280 +GLYYVDR+DPDLKRYPKLSAHWYS FLK RS+SSD ++KNFS ++ H +Q Sbjct: 454 YGLYYVDRDDPDLKRYPKLSAHWYSQFLKGRSLSSDEDFALEKNFSGPSYGHDYQ 508 >ref|XP_007050907.1| Beta glucosidase 11, putative [Theobroma cacao] gi|508703168|gb|EOX95064.1| Beta glucosidase 11, putative [Theobroma cacao] Length = 535 Score = 85.1 bits (209), Expect = 9e-15 Identities = 38/55 (69%), Positives = 44/55 (80%) Frame = -1 Query: 444 FGLYYVDREDPDLKRYPKLSAHWYSDFLKRRSISSDGVIEVDKNFSALAHAHSFQ 280 +GLYY+D +DPDLKRYPKLS WYS FLK S+S DGVIE+ KNFSAL+ H FQ Sbjct: 481 YGLYYIDLDDPDLKRYPKLSRDWYSHFLKGGSVSPDGVIELQKNFSALSQGHFFQ 535 >ref|XP_006486817.1| PREDICTED: beta-glucosidase 11-like isoform X5 [Citrus sinensis] Length = 469 Score = 81.6 bits (200), Expect = 1e-13 Identities = 35/50 (70%), Positives = 43/50 (86%) Frame = -1 Query: 444 FGLYYVDREDPDLKRYPKLSAHWYSDFLKRRSISSDGVIEVDKNFSALAH 295 +GLYYVDR+DPDLKRYPKLSAHWYS FLK RS+ SD V ++KN S+L++ Sbjct: 415 YGLYYVDRDDPDLKRYPKLSAHWYSQFLKGRSVRSDEVFSLEKNISSLSY 464 >ref|XP_006486815.1| PREDICTED: beta-glucosidase 11-like isoform X3 [Citrus sinensis] Length = 505 Score = 81.6 bits (200), Expect = 1e-13 Identities = 35/50 (70%), Positives = 43/50 (86%) Frame = -1 Query: 444 FGLYYVDREDPDLKRYPKLSAHWYSDFLKRRSISSDGVIEVDKNFSALAH 295 +GLYYVDR+DPDLKRYPKLSAHWYS FLK RS+ SD V ++KN S+L++ Sbjct: 451 YGLYYVDRDDPDLKRYPKLSAHWYSQFLKGRSVRSDEVFSLEKNISSLSY 500 >ref|XP_006486813.1| PREDICTED: beta-glucosidase 11-like isoform X1 [Citrus sinensis] gi|568866960|ref|XP_006486814.1| PREDICTED: beta-glucosidase 11-like isoform X2 [Citrus sinensis] Length = 528 Score = 81.6 bits (200), Expect = 1e-13 Identities = 35/50 (70%), Positives = 43/50 (86%) Frame = -1 Query: 444 FGLYYVDREDPDLKRYPKLSAHWYSDFLKRRSISSDGVIEVDKNFSALAH 295 +GLYYVDR+DPDLKRYPKLSAHWYS FLK RS+ SD V ++KN S+L++ Sbjct: 474 YGLYYVDRDDPDLKRYPKLSAHWYSQFLKGRSVRSDEVFSLEKNISSLSY 523 >ref|XP_002267595.2| PREDICTED: beta-glucosidase 11-like [Vitis vinifera] Length = 512 Score = 81.6 bits (200), Expect = 1e-13 Identities = 36/55 (65%), Positives = 44/55 (80%) Frame = -1 Query: 444 FGLYYVDREDPDLKRYPKLSAHWYSDFLKRRSISSDGVIEVDKNFSALAHAHSFQ 280 FGLYYVD +DPDLKRYPKLSAHWYS FLK ++SSDG I ++KN + ++ A S Q Sbjct: 458 FGLYYVDLDDPDLKRYPKLSAHWYSSFLKGENVSSDGAIGIEKNKTPVSSARSIQ 512 >emb|CBI36856.3| unnamed protein product [Vitis vinifera] Length = 984 Score = 81.6 bits (200), Expect = 1e-13 Identities = 36/54 (66%), Positives = 45/54 (83%) Frame = -1 Query: 444 FGLYYVDREDPDLKRYPKLSAHWYSDFLKRRSISSDGVIEVDKNFSALAHAHSF 283 FGLYYVD +DPDL+RYPKLSAHWYS FLKRR++SSD I ++KN + L++ SF Sbjct: 931 FGLYYVDLDDPDLRRYPKLSAHWYSSFLKRRNMSSDADIGIEKNKTPLSNVQSF 984 Score = 55.5 bits (132), Expect = 8e-06 Identities = 29/48 (60%), Positives = 33/48 (68%) Frame = -1 Query: 444 FGLYYVDREDPDLKRYPKLSAHWYSDFLKRRSISSDGVIEVDKNFSAL 301 +GLYYVD +DPDLKRYPKLSAHWYS ++ DG I FSAL Sbjct: 457 YGLYYVDLDDPDLKRYPKLSAHWYS-----VQVTKDGRI----TFSAL 495 >emb|CBI36854.3| unnamed protein product [Vitis vinifera] Length = 840 Score = 81.6 bits (200), Expect = 1e-13 Identities = 36/55 (65%), Positives = 44/55 (80%) Frame = -1 Query: 444 FGLYYVDREDPDLKRYPKLSAHWYSDFLKRRSISSDGVIEVDKNFSALAHAHSFQ 280 FGLYYVD +DPDLKRYPKLSAHWYS FLK ++SSDG I ++KN + ++ A S Q Sbjct: 625 FGLYYVDLDDPDLKRYPKLSAHWYSSFLKGENVSSDGAIGIEKNKTPVSSARSIQ 679 Score = 71.2 bits (173), Expect = 1e-10 Identities = 31/44 (70%), Positives = 37/44 (84%) Frame = -1 Query: 444 FGLYYVDREDPDLKRYPKLSAHWYSDFLKRRSISSDGVIEVDKN 313 +GLYYVD +DPDLKRYPKLSAHWYS FLK +ISS G + ++KN Sbjct: 112 YGLYYVDLDDPDLKRYPKLSAHWYSVFLKGSNISSVGAVGIEKN 155 >ref|XP_002268147.1| PREDICTED: beta-glucosidase 11-like isoform 1 [Vitis vinifera] Length = 527 Score = 81.6 bits (200), Expect = 1e-13 Identities = 36/54 (66%), Positives = 45/54 (83%) Frame = -1 Query: 444 FGLYYVDREDPDLKRYPKLSAHWYSDFLKRRSISSDGVIEVDKNFSALAHAHSF 283 FGLYYVD +DPDL+RYPKLSAHWYS FLKRR++SSD I ++KN + L++ SF Sbjct: 474 FGLYYVDLDDPDLRRYPKLSAHWYSSFLKRRNMSSDADIGIEKNKTPLSNVQSF 527 >ref|XP_006422698.1| hypothetical protein CICLE_v10029910mg [Citrus clementina] gi|557524632|gb|ESR35938.1| hypothetical protein CICLE_v10029910mg [Citrus clementina] Length = 624 Score = 80.9 bits (198), Expect = 2e-13 Identities = 35/50 (70%), Positives = 42/50 (84%) Frame = -1 Query: 444 FGLYYVDREDPDLKRYPKLSAHWYSDFLKRRSISSDGVIEVDKNFSALAH 295 +GLYYVDR DPDLKRYPKLSAHWYS FLK RS+ SD V ++KN S+L++ Sbjct: 570 YGLYYVDRHDPDLKRYPKLSAHWYSQFLKGRSVRSDEVFSLEKNISSLSY 619 >emb|CAN82274.1| hypothetical protein VITISV_040383 [Vitis vinifera] Length = 2003 Score = 79.7 bits (195), Expect = 4e-13 Identities = 35/54 (64%), Positives = 44/54 (81%) Frame = -1 Query: 444 FGLYYVDREDPDLKRYPKLSAHWYSDFLKRRSISSDGVIEVDKNFSALAHAHSF 283 FGLYYVD ++PDL+RYPKLSAHWYS FLKRR++SSD I ++KN + L+ SF Sbjct: 1950 FGLYYVDLDBPDLRRYPKLSAHWYSSFLKRRNMSSDXDIXIEKNKTPLSXXQSF 2003 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/51 (68%), Positives = 42/51 (82%) Frame = -1 Query: 444 FGLYYVDREDPDLKRYPKLSAHWYSDFLKRRSISSDGVIEVDKNFSALAHA 292 FGLYYVD +DPDLKRYPKLSAHWYSDFLK +SI+ D ++ KN AL++A Sbjct: 1523 FGLYYVDLDDPDLKRYPKLSAHWYSDFLKGKSITPDEANDITKNKMALSNA 1573 Score = 77.0 bits (188), Expect = 2e-12 Identities = 33/44 (75%), Positives = 38/44 (86%) Frame = -1 Query: 444 FGLYYVDREDPDLKRYPKLSAHWYSDFLKRRSISSDGVIEVDKN 313 FGLYYVD +DPDLKRYPKLSAHWYS FLK ++SSDG I ++KN Sbjct: 982 FGLYYVDLDDPDLKRYPKLSAHWYSXFLKGENVSSDGAIGIEKN 1025 Score = 59.3 bits (142), Expect = 5e-07 Identities = 24/43 (55%), Positives = 34/43 (79%) Frame = -1 Query: 444 FGLYYVDREDPDLKRYPKLSAHWYSDFLKRRSISSDGVIEVDK 316 +GLYYVD +DPDLKRYP LSAHWYS FLK ++ + ++ +++ Sbjct: 568 YGLYYVDLDDPDLKRYPXLSAHWYSVFLKGTNLIKEEMVGINQ 610 >ref|XP_007050911.1| Beta glucosidase 11 [Theobroma cacao] gi|508703172|gb|EOX95068.1| Beta glucosidase 11 [Theobroma cacao] Length = 511 Score = 78.2 bits (191), Expect = 1e-12 Identities = 36/55 (65%), Positives = 43/55 (78%) Frame = -1 Query: 444 FGLYYVDREDPDLKRYPKLSAHWYSDFLKRRSISSDGVIEVDKNFSALAHAHSFQ 280 +G YYVD +DPDLKRYPKLSAHWYS FLK SISSD +I++ +NF AL+ H Q Sbjct: 457 YGFYYVDLDDPDLKRYPKLSAHWYSHFLKGGSISSDVLIKLKQNFFALSQGHFSQ 511 >ref|XP_003632372.1| PREDICTED: beta-glucosidase 11-like [Vitis vinifera] Length = 502 Score = 75.9 bits (185), Expect = 6e-12 Identities = 34/51 (66%), Positives = 41/51 (80%) Frame = -1 Query: 444 FGLYYVDREDPDLKRYPKLSAHWYSDFLKRRSISSDGVIEVDKNFSALAHA 292 +GLYYVD +DPDLKRYPKLSAHWYS FLK R+I+ DG IE+ N + L+ A Sbjct: 452 YGLYYVDLDDPDLKRYPKLSAHWYSGFLKGRNITPDGPIEIQMNKTPLSDA 502 >emb|CBI36851.3| unnamed protein product [Vitis vinifera] Length = 551 Score = 75.9 bits (185), Expect = 6e-12 Identities = 34/51 (66%), Positives = 41/51 (80%) Frame = -1 Query: 444 FGLYYVDREDPDLKRYPKLSAHWYSDFLKRRSISSDGVIEVDKNFSALAHA 292 +GLYYVD +DPDLKRYPKLSAHWYS FLK R+I+ DG IE+ N + L+ A Sbjct: 501 YGLYYVDLDDPDLKRYPKLSAHWYSGFLKGRNITPDGPIEIQMNKTPLSDA 551 >emb|CAN81257.1| hypothetical protein VITISV_000964 [Vitis vinifera] Length = 409 Score = 75.9 bits (185), Expect = 6e-12 Identities = 34/51 (66%), Positives = 41/51 (80%) Frame = -1 Query: 444 FGLYYVDREDPDLKRYPKLSAHWYSDFLKRRSISSDGVIEVDKNFSALAHA 292 +GLYYVD +DPDLKRYPKLSAHWYS FLK R+I+ DG IE+ N + L+ A Sbjct: 359 YGLYYVDLDDPDLKRYPKLSAHWYSGFLKGRNITPDGPIEIQMNKTPLSDA 409 >ref|XP_002523071.1| beta-glucosidase, putative [Ricinus communis] gi|223537633|gb|EEF39256.1| beta-glucosidase, putative [Ricinus communis] Length = 511 Score = 75.1 bits (183), Expect = 9e-12 Identities = 36/56 (64%), Positives = 44/56 (78%), Gaps = 1/56 (1%) Frame = -1 Query: 444 FGLYYVDREDPDLKRYPKLSAHWYSDFLK-RRSISSDGVIEVDKNFSALAHAHSFQ 280 FGLYYVD DP+LKR PKLSAHWY+ FLK RR +SSD VI++ +N SA + +H FQ Sbjct: 456 FGLYYVDMNDPELKRSPKLSAHWYAQFLKGRRIVSSDPVIQLPQNVSAFSISHLFQ 511 >ref|XP_006422708.1| hypothetical protein CICLE_v10028386mg [Citrus clementina] gi|557524642|gb|ESR35948.1| hypothetical protein CICLE_v10028386mg [Citrus clementina] Length = 462 Score = 74.3 bits (181), Expect = 2e-11 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = -1 Query: 444 FGLYYVDREDPDLKRYPKLSAHWYSDFLKRRSISSDGV 331 +GLYYVDR+DPDLKRYPKLSAHWYS FLKRRS+ SD V Sbjct: 422 YGLYYVDRDDPDLKRYPKLSAHWYSQFLKRRSVRSDEV 459 >ref|XP_007050908.1| Beta glucosidase 11 isoform 1 [Theobroma cacao] gi|508703169|gb|EOX95065.1| Beta glucosidase 11 isoform 1 [Theobroma cacao] Length = 511 Score = 73.9 bits (180), Expect = 2e-11 Identities = 34/52 (65%), Positives = 40/52 (76%) Frame = -1 Query: 444 FGLYYVDREDPDLKRYPKLSAHWYSDFLKRRSISSDGVIEVDKNFSALAHAH 289 FG YYVD +DPDLKR PKLSA+WYS FLK S+SSD VI++ FSAL+ H Sbjct: 457 FGFYYVDLDDPDLKRQPKLSAYWYSHFLKGGSVSSDKVIDLKNKFSALSPGH 508 >ref|XP_002267643.2| PREDICTED: beta-glucosidase 11-like [Vitis vinifera] Length = 679 Score = 73.9 bits (180), Expect = 2e-11 Identities = 33/55 (60%), Positives = 42/55 (76%) Frame = -1 Query: 444 FGLYYVDREDPDLKRYPKLSAHWYSDFLKRRSISSDGVIEVDKNFSALAHAHSFQ 280 +GLYYVD +DPDLKRYPKLSAHWYS FLK ++I+ D ++ KN AL++A Q Sbjct: 625 YGLYYVDLDDPDLKRYPKLSAHWYSGFLKGKNITPDEANDITKNKMALSNARPIQ 679