BLASTX nr result
ID: Paeonia25_contig00030728
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00030728 (334 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPQ54945.1| hypothetical protein GLOTRDRAFT_43416 [Gloeophyll... 50 6e-06 >gb|EPQ54945.1| hypothetical protein GLOTRDRAFT_43416 [Gloeophyllum trabeum ATCC 11539] Length = 555 Score = 50.4 bits (119), Expect(2) = 6e-06 Identities = 23/48 (47%), Positives = 32/48 (66%) Frame = +3 Query: 171 DWKFLVAQICRLWREVALHTVHLWTDVVFIEEGPQSKHLAGLDRSKAA 314 +++ LV+ +CR WREVAL T +LWT + F E P K A ++RSK A Sbjct: 80 EFQVLVSHVCRRWREVALETPNLWTSIDFTEGPPFEKSRAWVERSKGA 127 Score = 25.0 bits (53), Expect(2) = 6e-06 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = +1 Query: 70 VNCLPVEILSHIFVVGA 120 +N LP E+L++IF VGA Sbjct: 24 INRLPPELLAYIFTVGA 40